Cart (0 Items)
Your cart is currently empty.
View ProductsHistamine H1 receptor(HRH1)
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Histamine H1 receptor(HRH1) |
|---|---|
| Uniprot ID | P35367 |
| Uniprot link | http://www.uniprot.org/uniprot/P35367 |
| Expression system | Prokaryotic expression |
| Sequence | MKIYKAVRQHCQHRELINRSLPSFSEIKLRPENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKMASPVVFSQEDDREVDKLYCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQGSHHHHHH |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | 0.02% Sarcosyl+PBS, pH7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Applications | ELISA,WB |
| Fragment Type | Lys212-Gln416 |
| Aliases /Synonyms | HRH1,H1R,HH1R |
| Reference | PX-P4596 |
| Note | For research use only |
Description of Histamine H1 receptor(HRH1)
General Information about Histamine H1 receptor (HRH1)
In the surrounding tissues, the H1 subclass of histamine receptors mediate the contraction of smooth muscles, the increase in capillary permeability due to the contraction of peripheral venules, the release of catecholamines from the adrenal medulla, and mediate the central nervous system Nerve transmission.
Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.