Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

? Special Offer?Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

? New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Annexin A2(ANXA2)

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P07355
Molecular weight:
38.61 kDa

€210.00

50ug +210 loyalty points
Met1–Asp339 N terminus His
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Annexin A2(ANXA2)

Annexin A2(ANXA2)

Product name Annexin A2(ANXA2)
Uniprot ID P07355
Uniprot link https://www.uniprot.org/uniprot/P07355
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIA FAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEIN RVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISI MTERSVPHLQKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVL IRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD*
Molecular weight 38.61 kDa
Protein delivered with Tag? N terminus His tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asp339
Protein Accession P07355
Spec:Entrez GeneID 302
Spec:NCBI Gene Aliases P36; ANX2; LIP2; LPC2; CAL1H; LPC2D; ANX2L4; PAP-IV; HEL-S-270
Spec:SwissProtID Q9UDH8
NCBI Reference P07355
Aliases /Synonyms Annexin II，Annexin-2，Calpactin I heavy chain，Calpactin-1 heavy chain，Chromobindin-8，Lipocortin II，Placental anticoagulant protein IV，PAP-IV ，Protein I，p36，ANX2, ANX2L4, CAL1H, LPC2D
Reference PX-P4794
Note For research use only
Molecular Constructor
Met1–Asp339 N terminus His
Product name Annexin A2(ANXA2)
Uniprot ID P07355
Uniprot link https://www.uniprot.org/uniprot/P07355
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIA FAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEIN RVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISI MTERSVPHLQKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVL IRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD*
Molecular weight 38.61 kDa
Protein delivered with Tag? N terminus His tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asp339
Protein Accession P07355
Spec:Entrez GeneID 302
Spec:NCBI Gene Aliases P36; ANX2; LIP2; LPC2; CAL1H; LPC2D; ANX2L4; PAP-IV; HEL-S-270
Spec:SwissProtID Q9UDH8
NCBI Reference P07355
Aliases /Synonyms Annexin II，Annexin-2，Calpactin I heavy chain，Calpactin-1 heavy chain，Chromobindin-8，Lipocortin II，Placental anticoagulant protein IV，PAP-IV ，Protein I，p36，ANX2, ANX2L4, CAL1H, LPC2D
Reference PX-P4794
Note For research use only
Molecular Constructor
Met1–Asp339 N terminus His

There are no reviews yet.

Be the first to review “Annexin A2(ANXA2)”

Your email address will not be published. Required fields are marked *

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products