Brand: ProteoGenix

Anti-ORF7a protein polyclonal antibody

PTXCOV-A559
Quality Chart

Note:: For research use and in vitro diagnostic only. Not suitable for human use.

€169.00

100ug +169 loyalty points

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Anti-ORF7a protein polyclonal antibody

Product name	Anti-ORF7a protein polyclonal antibody
Source	P0DTC7
Species	SARS-CoV-2
Molecular weight	13kDa
Buffer	PBS, pH7.4, containing 0.05% proclin300, 50% glycerol
Form	Liquid
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term; -20°c or -80°C for long term
Brand	Proteogenix
Host species	Rabbit
Aliases – Synonyms	ORF7a protein
Size	100ug
Reference	PTXCOV-A559
Note	For research use and in vitro diagnostic only. Not suitable for human use.
Isotype	IgG
Clonality	Polyclonal Antibody
Target	ORF7a: MKIILFLALITLATCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYSPIFLIVAAIVFITLCFTLKRKTE

There are no reviews yet.

Be the first to review “Anti-ORF7a protein polyclonal antibody”

Your email address will not be published. Required fields are marked *

Your rating *

In which application did you use the antibody? *

Did it work in your application? * Yes No

Your review *

Name *

Email *

Anti-ORF7a protein polyclonal antibody

Anti-ORF7a protein polyclonal antibody

Can’t find what you need?

Cart (0 Items)

Anti-ORF7a protein polyclonal antibody

Specifications Anti-ORF7a protein polyclonal antibody

Reviews

Can’t find what you need?

Cart (0 Items)

Anti-ORF7a protein polyclonal antibody