Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

? Special Offer?Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

? New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Carnitine O-palmitoyltransferase 1, liver isoform(CPT1A)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P50416
Molecular weight:
38.45 kDa

210.00

50ug +210 loyalty points
His Gln406–Thr745
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Carnitine O-palmitoyltransferase 1, liver isoform(CPT1A)

Product name Carnitine O-palmitoyltransferase 1, liver isoform(CPT1A)
Uniprot ID P50416
Uniprot link https://www.uniprot.org/uniprot/P50416
Expression system Prokaryotic expression
Raw Antigen Sequence QSLDAVEKAAFFVTLDETEEGYRSEDPDTSMDSYAKSLLHGRCYDRWFDKSFTFVVFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSLQLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFPFVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCDFVRAMVDPAQTVEQRLKLFKLASEKHQHMYRLAMTGSGIDRHLFCLYVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLINFHISSKFSCPET
Molecular weight 38.45 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln406-Thr745
Protein Accession P50416
Spec:Entrez GeneID 1374
Spec:NCBI Gene Aliases CPT1; CPT1-L; L-CPT1
Spec:SwissProtID Q8TCU0
NCBI Reference P50416
Aliases /Synonyms CPT1-L,Carnitine O-palmitoyltransferase I, liver isoform,CPT I,CPTI-L,Carnitine palmitoyltransferase 1A,CPT1A,CPT1
Reference PX-P4721
Note For research use only
Molecular Constructor
His Gln406–Thr745
Product name Carnitine O-palmitoyltransferase 1, liver isoform(CPT1A)
Uniprot ID P50416
Uniprot link https://www.uniprot.org/uniprot/P50416
Expression system Prokaryotic expression
Raw Antigen Sequence QSLDAVEKAAFFVTLDETEEGYRSEDPDTSMDSYAKSLLHGRCYDRWFDKSFTFVVFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSLQLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFPFVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCDFVRAMVDPAQTVEQRLKLFKLASEKHQHMYRLAMTGSGIDRHLFCLYVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLINFHISSKFSCPET
Molecular weight 38.45 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln406-Thr745
Protein Accession P50416
Spec:Entrez GeneID 1374
Spec:NCBI Gene Aliases CPT1; CPT1-L; L-CPT1
Spec:SwissProtID Q8TCU0
NCBI Reference P50416
Aliases /Synonyms CPT1-L,Carnitine O-palmitoyltransferase I, liver isoform,CPT I,CPTI-L,Carnitine palmitoyltransferase 1A,CPT1A,CPT1
Reference PX-P4721
Note For research use only
Molecular Constructor
His Gln406–Thr745

There are no reviews yet.

Be the first to review “Carnitine O-palmitoyltransferase 1, liver isoform(CPT1A)”

Your email address will not be published. Required fields are marked *

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products