Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

? Special Offer?Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

? New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

CD152 Recombinant Protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P16410
Molecular weight:
18.51kDa

420.00

100ug +420 loyalty points
Met1~Asp161 His
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

CD152 Recombinant Protein

Product name CD152 Recombinant Protein
Uniprot ID P16410
Uniprot link http://www.uniprot.org/uniprot/P16410
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSD
Molecular weight 18.51kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Asp161
Aliases /Synonyms CD152
Reference PX-P4108
Note For research use only
Molecular Constructor
Met1~Asp161 His

General information on CD152 Recombinant Protein:

CD152, also known as CTLA4 and cytotoxic T lymphocyte protein 4, is a single-pass type I membrane protein and a member of the immunoglobulin superfamily. It is the second member of the CD28 receptor. The ligands or counterreceptors of these two proteins belong to the B7, CD8 (B7-1) and CD86 (B7-2) families. CTLA4 delivers inhibitory signals to T lymphocytes, while CD28 delivers stimulatory signals. Intracellular CTLA4 is also present in regulatory T cells and may play an important role in its function. CD152 antigen or cytotoxic T lymphocytes (CTLA-4) are important receptors involved in downregulating T-cell activation. Due to its far-reaching inhibitory effect, CD152 is considered a candidate solid acceptable for autoimmunity and a convincing target for cancer immunotherapy. In particular, recent evidence suggests that CD152 is also important in homeostasis and the function of population suppressor cells called regulatory T cells (Treg).

Tremelimumab Biosimilar - Anti-CTLA4, CD152 mAb binds to CD152 Recombinant Protein in indirect ELISA Assay

Tremelimumab Biosimilar - Anti-CTLA4, CD152 mAb binds to CD152 Recombinant Protein in indirect ELISA Assay

Immobilized CD152 Recombinant Protein (cat. No.PX-P4108) at 0.5µg/mL (100µL/well) can bind to Tremelimumab Biosimilar - Anti-CTLA4, CD152 mAb (cat. No.PX-TA1177) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

There are no reviews yet.

Be the first to review “CD152 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products