Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

? Special Offer?Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

? New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

CD160 antigen(1-158)

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
O95971
Molecular weight:
22.52kDa

210.00

50ug +210 loyalty points
Met1–Leu158
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

CD160 antigen(1-158)

Product name CD160 antigen(1-194)
Uniprot ID O95971
Uniprot link https://www.uniprot.org/uniprot/O95971
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSSGFLQEKVWVMLVTSLVALQGMSKRAVSTPSNEGAGGGSGGHHHHHHHH
Molecular weight 22.52kDa
Purity estimated >70% by SDS-PAGE
Buffer PBS, pH=7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ala194
Aliases /Synonyms Natural killer cell receptor BY55,CD_antigen: CD160,BY55,CD160-TM
Reference PX-P4287
Note For research use only
Molecular Constructor
Met1–Leu158
Product name CD160 antigen(1-194)
Uniprot ID O95971
Uniprot link https://www.uniprot.org/uniprot/O95971
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSSGFLQEKVWVMLVTSLVALQGMSKRAVSTPSNEGAGGGSGGHHHHHHHH
Molecular weight 22.52kDa
Purity estimated >70% by SDS-PAGE
Buffer PBS, pH=7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ala194
Aliases /Synonyms Natural killer cell receptor BY55,CD_antigen: CD160,BY55,CD160-TM
Reference PX-P4287
Note For research use only
Molecular Constructor
Met1–Leu158

General information on CD160 antigen (CD160):

The CD160 antigen is a protein encoded by the CD160 gene in humans. CD160 is a glycoprotein that was originally identified with the monoclonal antibody BY55. Its expression is strictly related to peripheral blood NK cells and cytolytically active CD8 T lymphocytes. The CD160 cDNA sequence can be predicted to be rich in 18-colored glycosylphosphatidylinositol amino acids, with a single Ig-like domain that is weakly homologous to the KIR2DL4 molecule. CD160 is expressed on the cell surface as a multimer with tightly bound disulfide bonds. Northern blot analysis showed that the CD160 mRNA was 1.5 and 1.6 kb, and its expression was very limited to circulating NK and T cells, spleen, and small intestine. In NK cells, CD160 is expressed by CD56dimCD16 + cells, while in circulating T cells, its expression is mainly limited to cells carrying TCRgd and TCRab + CD8brightCD95 + CD56 + CD28-CD27-CD27 cells. In tissue, CD160 is expressed on all intestinal intraepithelial lymphocytes. CD160 exhibits broad specificity for the binding of classical and unconventional MHC class I molecules.

There are no reviews yet.

Be the first to review “CD160 antigen(1-158)”

Your email address will not be published. Required fields are marked *

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products