Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

? Special Offer?Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

? New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

CD20 Protein – Human CD20 Recombinant Protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P11836
Molecular weight:
10.98 kDa

210.00

50ug +210 loyalty points
His Glu213–Pro297
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

CD20 Protein - Human CD20 Recombinant Protein

Product name CD20 Protein - Human CD20 Recombinant Protein
Uniprot ID P11836
Uniprot link http://www.uniprot.org/uniprot/P11836
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MGSHHHHHHSGENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFPE PPQDQESSPIENDSSP
Molecular weight 10.98 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated 90%
Buffer PBS,pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu213-Pro297
NCBI Reference P11836
Aliases /Synonyms B-lymphocyte antigen CD20, B-lymphocyte surface antigen B1, Bp35, Leukocyte surface antigen Leu-16, Membrane-spanning 4-domains subfamily A member 1, CD_antigen: CD20, MS4A1
Reference PX-P3060
Note For research use only
Molecular Constructor
His Glu213–Pro297
Product name CD20 Protein - Human CD20 Recombinant Protein
Uniprot ID P11836
Uniprot link http://www.uniprot.org/uniprot/P11836
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MGSHHHHHHSGENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFPE PPQDQESSPIENDSSP
Molecular weight 10.98 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated 90%
Buffer PBS,pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu213-Pro297
NCBI Reference P11836
Aliases /Synonyms B-lymphocyte antigen CD20, B-lymphocyte surface antigen B1, Bp35, Leukocyte surface antigen Leu-16, Membrane-spanning 4-domains subfamily A member 1, CD_antigen: CD20, MS4A1
Reference PX-P3060
Note For research use only
Molecular Constructor
His Glu213–Pro297

General information on CD20 :

Cd20 protein is a 33-37 kDa polypeptide encoded by the MS4A1 gene in humans. The protein has three transmembrane hydrophobic regions. The 85 amino acid carboxyl terminal regions of the protein is located within the cytoplasm. The length of this region in particular contrasts with the structure of other B-cell specific structures such as IgM, IgD, IgG heavy chains. Due to its multiple membrane spanning, the protein structure of CD20 resembles to that of an ion channel. There are multiple forms of CD20 proteins which derive from different CD20 phosphorylation patterns. The human CD20 protein has four transmembrane protein and is not glycosylated. The protein has no known major sequence homology to other proteins.
The precised physiological role of the proteins remains unknown, however, it has been shown that the protein is involved in the regulation of B-cell activation, proliferation and differentiation. The CD20 protein is expressed on the surface of B-cells. CD20 protein has no known ligand. However, its function is to unable B-cell immune response, particularly against T-independent ligands. Their expression is upmodulated upon B-cell activation.
The protein is also expressed at the surface germinal center cells and mantel cells of the lymph node. CD20 is also dimly expressed by a subset of T lymphocytes displaying CD8+, CD28+, CD38+, CD45RO+, TCR+, HLA-DR-phenotype which has been described in bone marrow and peripheral blood.
CD20 protein is also present in follicular dendric cells.

CD20 has been reported to be linked to:
• Neoplastic diseases of B cell precursor
• Neoplastic diseases of T cell precursor
• Acute Leukemias
• Neoplastic diseases of mature B cells
• Neoplastic diseases of mature T and NK cells

SDS-PAGE for CD20 Protein - Human CD20 Recombinant Protein

SDS-PAGE for CD20 Protein - Human CD20 Recombinant Protein

CD20 Protein - Human CD20 Recombinant Protein, on SDS-PAGE under reducing

  • Meissner JM, Toporkiewicz M, Czogalla A, Matusewicz L, Kuliczkowski K, Sikorski AF. Novel antisense therapeutics delivery systems: In vitro and in vivo studies of liposomes targeted with anti-CD20 antibody. J Control Release. 2015 Dec 28;220(Pt A):515-28. doi: 10.1016/j.jconrel.2015.11.015. Epub 2015 Nov 14. PubMed PMID: 26585505.
  • Li J, Zhao S, Wang J, Chen J, Wen W, Zhang Q. CD20-negative diffuse large B cell lymphoma: a comprehensive analysis of 695 cases. Tumour Biol. 2016 Mar;37(3):3619-37. doi: 10.1007/s13277-015-4205-5. Epub 2015 Oct 12. Review. PubMed PMID: 26459310.
  • Salva KA, Bennett D, Longley J, Guitart J, Wood GS. Multispectral Imaging Approach to the Diagnosis of a CD20+ Cutaneous T-cell Lymphoproliferative Disorder: A Case Report. Am J Dermatopathol. 2015 Oct;37(10):e116-21. doi: 10.1097/DAD.0000000000000323. PubMed PMID: 26381030; PubMed Central PMCID: PMC4576727.
  • Gu L, Hong L, Ling Z, Feng J, Zheng Z, Du L, Mou H, Sun W, Kong X, Ling Y, Jiang Z, Zhu C, Mao W, Qian L. Establishment and Characterization of a CD20-Positive NK/T-Cell Lymphoma Cell Line. Clin Lab. 2015;61(7):731-9. PubMed PMID: 26299072.
  • Degheidy H, Abbasi F, Mostowski H, Gaigalas AK, Marti G, Bauer S, Wang L. Consistent, multi-instrument single tube quantification of CD20 in antibody bound per cell based on CD4 reference. Cytometry B Clin Cytom. 2016 Mar;90(2):159-67. doi: 10.1002/cyto.b.21253. Epub 2015 Jul 6. PubMed PMID: 26013593.
  • Vauchy C, Gamonet C, Ferrand C, Daguindau E, Galaine J, Beziaud L, Chauchet A, Henry Dunand CJ, Deschamps M, Rohrlich PS, Borg C, Adotevi O, Godet Y. CD20 alternative splicing isoform generates immunogenic CD4 helper T epitopes. Int J Cancer. 2015 Jul 1;137(1):116-26. doi: 10.1002/ijc.29366. Epub 2014 Dec 12. PubMed PMID: 25449106.
  • Khedmat H, Ghamar-Chehreh ME, Amini M. Significance of CD20 expression by lymphoproliferative lesions developing after liver transplantation: post-transplant lymphoproliferative disorders international survey. Saudi J Kidney Dis Transpl. 2014 Nov;25(6):1293-300. Review. PubMed PMID: 25394454.
  • Palanichamy A, Jahn S, Nickles D, Derstine M, Abounasr A, Hauser SL, Baranzini SE, Leppert D, von Büdingen HC. Rituximab efficiently depletes increased CD20-expressing T cells in multiple sclerosis patients. J Immunol. 2014 Jul 15;193(2):580-6. doi: 10.4049/jimmunol.1400118. Epub 2014 Jun 13. PubMed PMID: 24928997; PubMed Central PMCID: PMC4082756.
  • Zhang LN, Wang L, Fang C, Zou ZJ, Fan L, Zhang R, Young KH, Li JY, Xu W. The significance of single nucleotide polymorphism rs2070770 in CD20 gene in Chinese patients with diffuse large B-cell lymphoma. Leuk Lymphoma. 2015 Mar;56(3):676-81. doi: 10.3109/10428194.2014.927455. Epub 2014 Jul 17. PubMed PMID: 24898664.
  • Harms KL, Harms PW, Anderson T, Betz BL, Ross CW, Fullen DR, Hristov AC. Mycosis fungoides with CD20 expression: report of two cases and review of the literature. J Cutan Pathol. 2014 Jun;41(6):494-503. doi: 10.1111/cup.12299. Epub 2014 Feb 26. Review. PubMed PMID: 24467775.
  • Liu J, Gu Z, Yang Y, Wendlandt E, Xu H. A subset of CD20(+) MM patients without the t(11;14) are associated with poor prognosis and a link to aberrant expression of Wnt signaling. Hematol Oncol. 2014 Dec;32(4):215-7. doi: 10.1002/hon.2120. Epub 2014 Jan 9. PubMed PMID: 24408089; PubMed Central PMCID: PMC4449615.
  • Batran SE, Salih MM, Elhassan EM, Mohmmed AA, Adam I. CD20, CD3, placental malaria infections and low birth weight in an area of unstable malaria transmission in Central Sudan. Diagn Pathol. 2013 Nov 18;8:189. doi: 10.1186/1746-1596-8-189. PubMed PMID: 24245949; PubMed Central PMCID: PMC3937234.
  • Jullié ML, Carlotti M, Vivot A Jr, Beylot-Barry M, Ortonne N, Frouin E, Carlotti A, de Muret A, Balme B, Franck F, Merlio JP, Vergier B. CD20 antigen may be expressed by reactive or lymphomatous cells of transformed mycosis fungoides: diagnostic and prognostic impact. Am J Surg Pathol. 2013 Dec;37(12):1845-54. doi: 10.1097/PAS.0000000000000091. PubMed PMID: 24145652.
  • Fang C, Zhuang Y, Wang L, Fan L, Wu YJ, Zhang R, Zou ZJ, Zhang LN, Yang S, Xu W, Li JY. High levels of CD20 expression predict good prognosis in chronic lymphocytic leukemia. Cancer Sci. 2013 Aug;104(8):996-1001. doi: 10.1111/cas.12192. Epub 2013 Jun 7. PubMed PMID: 23659384.
  • Jiqiu W, Jinsong C, Dongrui C, Mingchao Z, Shuming J, Zhi-Hong L. CD20+ B-cell infiltration is related to the time after transplant and poor prognosis of acute cellular rejection in renal transplant. Exp Clin Transplant. 2013 Oct;11(5):412-7. doi: 10.6002/ect.2012.0143. Epub 2013 Feb 21. PubMed PMID: 23428174.
  • Jiang QP, Liu SY, Yang YX, Tan XX, Peng J, Xiong ZT, Li Z. CD20-positive NK/T-cell lymphoma with indolent clinical course: report of case and review of literature. Diagn Pathol. 2012 Oct 2;7:133. doi: 10.1186/1746-1596-7-133. Review. PubMed PMID: 23031227; PubMed Central PMCID: PMC3502398.

There are no reviews yet.

Be the first to review “CD20 Protein – Human CD20 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products