Brand: ProteoGenix

CD265 Recombinant Protein

PX-P4124-100
Quality Chart

Host species:: Mammalian cells
Origin species:: Homo sapiens (Human)
Uniprot ID:: Q9Y6Q6
Molecular weight:: 25-28kDa

€420.00

100ug +420 loyalty points

Met1–Pro212 His

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

CD265 Recombinant Protein

Product name	CD265 Recombinant Protein
Uniprot ID	Q9Y6Q6
Uniprot link	http://www.uniprot.org/uniprot/Q9Y6Q6
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Raw Antigen Sequence	MAPRARRRRPLFALLLLCALLARLQVALQIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARKPPNEPHVYLP
Molecular weight	25-28kDa
Protein delivered with Tag?	C-terminal His Tag
Purity estimated	>95% by SDS-PAGE
Buffer	PBS pH7.5
Delivery condition	Dry Ice
Storage condition	Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Met1-Pro212
Aliases /Synonyms	ODFR
Reference	PX-P4124
Note	For research use only
Molecular Constructor	Met1–Pro212 His

There are no reviews yet.

Be the first to review “CD265 Recombinant Protein”

CD265 Recombinant Protein

CD265 Recombinant Protein

Can’t find what you need?

Cart (0 Items)

CD265 Recombinant Protein

Specifications CD265 Recombinant Protein

Documents

Reviews

Can’t find what you need?

Cart (0 Items)

CD265 Recombinant Protein