Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

? Special Offer?Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

? New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

CD344 Recombinant Protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q9ULV1
Molecular weight:
22-28kDa

420.00

100ug +420 loyalty points
Met1–Glu180 His
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

CD344 Recombinant Protein

Product name CD344 Recombinant Protein
Uniprot ID Q9ULV1
Uniprot link http://www.uniprot.org/uniprot/Q9ULV1
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MAWRGAGPSVPGAPGGVGLSLGLLLQLLLLLGPARGFGDEEERRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEE
Molecular weight 22-28kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Glu180
Aliases /Synonyms EVR1,FEVR,Fz-4,Fz4,FZD4S,FzE4,GPCR,hFz4
Reference PX-P4122
Note For research use only
Molecular Constructor
Met1–Glu180 His

There are no reviews yet.

Be the first to review “CD344 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products