Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

? Special Offer?Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

? New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

CD95 Recombinant Protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P25445
Molecular weight:
30kDa

420.00

100ug +420 loyalty points
Met1~Asn173 His
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

CD95 Recombinant Protein

Product name CD95 Recombinant Protein
Uniprot ID P25445
Uniprot link http://www.uniprot.org/uniprot/P25445
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSN
Molecular weight 30kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Asn173
Aliases /Synonyms APT1, FAS1, TNFRSF6
Reference PX-P4095
Note For research use only
Molecular Constructor
Met1~Asn173 His

General information on CD95 Recombinant Protein:

CD95 (APO-1 / Fas) is an important inducer of the extreme apoptosis signaling pathway. Therapeutic induction of apoptosis of many tumor cells has been linked to the activity of CD95. It is a typical death receptor, characterized by the presence of an 8 amino acid death domain in its cytoplasmic tail. This advantage is essential for the recruitment of a large number of signal components after activation of the agonist anti-CD95 antibody or bound CD95 ligand that initiates apoptosis. The protein complex formed after the release of CD95 is called the lethal induction signal complex. DISK is composed of adaptive proteins and priming caspins, which are essential to induce apoptosis. CD95 is also the key to negative selection of B cells in the reproductive center (GC). Impairment of CD95-mediated apoptosis leads to impaired affinity maturation and persistence of spontaneous B cell clones. Changes in the expression of CD95 and / or its CD95L ligand are often found in human cancers. CD95 down-regulation or mutation has been proposed to be a mechanism by which cancer cells prevent destruction of the immune system through reduced sensitivity to apoptosis. Therefore, CD95 is considered a tumor remover. CD95 is reported to be involved in the activation of NF-κB, MAPK3 / ERK1, MAPK8 / JNK, and alternative pathways of CTL-mediated cytotoxicity. Therefore, the protein is involved in the pathogenesis of various malignant tumors and diseases of the immune system. The CD95 / CD95L system is related to the etiology of inflammatory bowel disease (IBD), mainly because CD95 is found to be highly expressed in intestinal epithelial cells and increases epithelial cell apoptosis in IBD.

There are no reviews yet.

Be the first to review “CD95 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products