Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

? Special Offer?Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

? New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Cell division protein FtsA(ftsA)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
WP_000588463.1
Molecular weight:
46.27kDa

210.00

50ug +210 loyalty points
full length
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Cell division protein FtsA(ftsA)

Product name Cell division protein FtsA(ftsA)
Uniprot ID WP_000588463.1
Uniprot link http://www.uniprot.org/uniprot/WP_000588463.1
Expression system Prokaryotic expression
Raw Antigen Sequence MGIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQAELMADCQISSV YLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVH LITCHNDMAKNIVKAVERCGLKVDQLIFAGLAASYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVV TSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQEQL RQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEK RVTASVGSWIKRLNSWLRKEFGSHHHHHH
Molecular weight 46.27kDa
Purity estimated 90% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type full length
Reference PX-P4514
Note For research use only
Molecular Constructor
full length
Product name Cell division protein FtsA(ftsA)
Uniprot ID WP_000588463.1
Uniprot link http://www.uniprot.org/uniprot/WP_000588463.1
Expression system Prokaryotic expression
Raw Antigen Sequence MGIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQAELMADCQISSV YLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVH LITCHNDMAKNIVKAVERCGLKVDQLIFAGLAASYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVV TSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQEQL RQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEK RVTASVGSWIKRLNSWLRKEFGSHHHHHH
Molecular weight 46.27kDa
Purity estimated 90% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type full length
Reference PX-P4514
Note For research use only
Molecular Constructor
full length

General Information about Cell division protein FtsA

FtsA stands for “filamentous temperature sensitive A”. FtsA is a bacterial protein that is related to actin through overall structural similarity and its ATP binding pocket. These proteins, along with other bacterial actin homologs (such as MreB, ParM, and MamK), suggest that eukaryotic actins share a common lineage. Like other bacterial actins, FtsA binds to ATP and can form actin-like filaments. The FtsA-FtsA interface has been determined through structural analysis and genetic analysis. Although FtsA is present in many different gram-positive and gram-negative bacterial species, it is not present in actinomycetes and cyanobacteria. The structure of FtsA is also similar to type IV fimbriae ATPase PilM

There are no reviews yet.

Be the first to review “Cell division protein FtsA(ftsA)”

Your email address will not be published. Required fields are marked *

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products