Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

? Special Offer?Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

? New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Creatine kinase MB(CKMB)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P06732&P12277
Molecular weight:
45kDa & 45kDa

210.00

50ug +210 loyalty points
His Met1–Lys381 CKM&CKB Strep
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Creatine kinase MB(CKMB)

Product name Creatine kinase MB(CKMB)
Uniprot ID P06732&P12277
Uniprot link https://www.uniprot.org/uniprot/P06732
Expression system Prokaryotic expression
Raw Antigen Sequence MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK & MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQKL
Molecular weight 45kDa & 45kDa
Protein delivered with Tag? C-terminal Strep tag & N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer 50 mM Tris-HCl pH 8.0, 150 mM NaCl
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type CKM(Met1-Lys381)&CKB(Met1-Lys381)
Protein Accession P06732&P12277
Spec:Entrez GeneID 1158&1152
Spec:NCBI Gene Aliases CKMM; M-CK; CPK-M
Spec:SwissProtID Q96QL9&Q2LE07
NCBI Reference P06732&P12277
Aliases /Synonyms CKMB,Creatine kinase M chain;Creatine phosphokinase M-typeCurated;CPK-M;M-CK & Brain creatine kinase1 Publication;B-CK;Creatine kinase B chain1 Publication;Creatine phosphokinase B-type;CPK-B
Reference PX-P4572
Note For research use only
Molecular Constructor
His Met1–Lys381 CKM&CKB Strep
Product name Creatine kinase MB(CKMB)
Uniprot ID P06732&P12277
Uniprot link https://www.uniprot.org/uniprot/P06732
Expression system Prokaryotic expression
Raw Antigen Sequence MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK & MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQKL
Molecular weight 45kDa & 45kDa
Protein delivered with Tag? C-terminal Strep tag & N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer 50 mM Tris-HCl pH 8.0, 150 mM NaCl
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type CKM(Met1-Lys381)&CKB(Met1-Lys381)
Protein Accession P06732&P12277
Spec:Entrez GeneID 1158&1152
Spec:NCBI Gene Aliases CKMM; M-CK; CPK-M
Spec:SwissProtID Q96QL9&Q2LE07
NCBI Reference P06732&P12277
Aliases /Synonyms CKMB,Creatine kinase M chain;Creatine phosphokinase M-typeCurated;CPK-M;M-CK & Brain creatine kinase1 Publication;B-CK;Creatine kinase B chain1 Publication;Creatine phosphokinase B-type;CPK-B
Reference PX-P4572
Note For research use only
Molecular Constructor
His Met1–Lys381 CKM&CKB Strep

There are no reviews yet.

Be the first to review “Creatine kinase MB(CKMB)”

Your email address will not be published. Required fields are marked *

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products