Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

? Special Offer?Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

? New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Disintegrin and metalloproteinase domain-containing protein 10(ADAM10)

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
O14672
Molecular weight:
32.34 kDa

142.00

100ug +142 loyalty points
Thr214–Ser504 N terminus His
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Disintegrin and metalloproteinase domain-containing protein 10(ADAM10)

Product name Disintegrin and metalloproteinase domain-containing protein 10(ADAM10)
Uniprot ID O14672
Uniprot link https://www.uniprot.org/uniprot/O14672
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence TTSAEKYTCQLYIQTDHLFFKYYGTREAVIAQISSHVKAIDTIYQTTDFSGIRNISFMVKRIRINTTADEKD PTNPFRFPNIGVEKFLELNSEQNHDDYCLAYVFTDRDFDDGVLGLAWVGAPSGSSGGICEKSKLYSDGKKKS LNTGIITVQNYGSHVPPKVSHITFAHEVGHNFGSPHDSGTECTPGESKNLGQKENGNYIMYARATSGDKLNN NKFSLCSIRNISQVLEKKRNNCFVESGQPICGNGMVEQGEECDCGYSDQCKDECCFDANQPEGRKCKLKPGK QCS
Molecular weight 32.34 kDa
Protein delivered with Tag? N terminus His tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr214-Ser504
Protein Accession O14672
Spec:Entrez GeneID 102
Spec:NCBI Gene Aliases RAK; kuz; AD10; AD18; MADM; CD156c; CDw156; HsT18717
Spec:SwissProtID Q92650
NCBI Reference O14672
Aliases /Synonyms ADAM 10,CDw156,Kuzbanian protein homolog,Mammalian disintegrin-metalloprotease,CD_antigen: CD156c,KUZ, MADM
Reference PX-P4796
Note For research use only
Molecular Constructor
Thr214–Ser504 N terminus His
Product name Disintegrin and metalloproteinase domain-containing protein 10(ADAM10)
Uniprot ID O14672
Uniprot link https://www.uniprot.org/uniprot/O14672
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence TTSAEKYTCQLYIQTDHLFFKYYGTREAVIAQISSHVKAIDTIYQTTDFSGIRNISFMVKRIRINTTADEKD PTNPFRFPNIGVEKFLELNSEQNHDDYCLAYVFTDRDFDDGVLGLAWVGAPSGSSGGICEKSKLYSDGKKKS LNTGIITVQNYGSHVPPKVSHITFAHEVGHNFGSPHDSGTECTPGESKNLGQKENGNYIMYARATSGDKLNN NKFSLCSIRNISQVLEKKRNNCFVESGQPICGNGMVEQGEECDCGYSDQCKDECCFDANQPEGRKCKLKPGK QCS
Molecular weight 32.34 kDa
Protein delivered with Tag? N terminus His tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr214-Ser504
Protein Accession O14672
Spec:Entrez GeneID 102
Spec:NCBI Gene Aliases RAK; kuz; AD10; AD18; MADM; CD156c; CDw156; HsT18717
Spec:SwissProtID Q92650
NCBI Reference O14672
Aliases /Synonyms ADAM 10,CDw156,Kuzbanian protein homolog,Mammalian disintegrin-metalloprotease,CD_antigen: CD156c,KUZ, MADM
Reference PX-P4796
Note For research use only
Molecular Constructor
Thr214–Ser504 N terminus His

There are no reviews yet.

Be the first to review “Disintegrin and metalloproteinase domain-containing protein 10(ADAM10)”

Your email address will not be published. Required fields are marked *

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products