Brand: ProteoGenix

DNA-binding protein H-NS (hns)

PX-P4380-50
Quality Chart

Host species:: Escherichia coli (E.coli)
Uniprot ID:: P0ACF9
Molecular weight:: 17.63kDa

€210.00

50ug +210 loyalty points

Met12–Gln156

size size

50ug €210.00
100ug €394.00

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

DNA-binding protein H-NS (hns)

Product name	DNA-binding protein H-NS (hns)
Uniprot ID	P0ACF9
Uniprot link	https://www.uniprot.org/uniprot/P0ACF9
Expression system	Prokaryotic expression
Raw Antigen Sequence	MGSHHHHHHSGLEVLFQGPMSEALKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEESAAAAEVEERTRKLQQY REMLIADGIDPNELLNSLAAVKSGTKAKRAQRPAKYSYVDENGETKTWTGQGRTPAVIKKAMDEQGKSLDDFLIKQ
Molecular weight	17.63kDa
Purity estimated	40% by SDS-PAGE
Buffer	20 mM Tris HCl, pH 8.0, 2 mM MgCl2, and 20 mM NaCl
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Met12-Gln156
Aliases /Synonyms	DNA-binding protein H-NS, Histone-like protein HLP-II, Protein B1, Protein H1
Reference	PX-P4380
Note	For research use only
Molecular Constructor	Met12–Gln156

Product name	DNA-binding protein H-NS (hns)
Uniprot ID	P0ACF9
Uniprot link	https://www.uniprot.org/uniprot/P0ACF9
Expression system	Prokaryotic expression
Raw Antigen Sequence	MGSHHHHHHSGLEVLFQGPMSEALKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEESAAAAEVEERTRKLQQY REMLIADGIDPNELLNSLAAVKSGTKAKRAQRPAKYSYVDENGETKTWTGQGRTPAVIKKAMDEQGKSLDDFLIKQ
Molecular weight	17.63kDa
Purity estimated	40% by SDS-PAGE
Buffer	20 mM Tris HCl, pH 8.0, 2 mM MgCl2, and 20 mM NaCl
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Met12-Gln156
Aliases /Synonyms	DNA-binding protein H-NS, Histone-like protein HLP-II, Protein B1, Protein H1
Reference	PX-P4380
Note	For research use only
Molecular Constructor	Met12–Gln156

There are no reviews yet.

Be the first to review “DNA-binding protein H-NS (hns)”

DNA-binding protein H-NS (hns)

DNA-binding protein H-NS (hns)

Can’t find what you need?

Cart (0 Items)

DNA-binding protein H-NS (hns)

Specifications DNA-binding protein H-NS (hns)

Documents

Reviews

Can’t find what you need?

Cart (0 Items)

DNA-binding protein H-NS (hns)