Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

? Special Offer?Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

? New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

DNase1-Dockerine chimeric construct(DNASE1)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P00639
Molecular weight:
41.4kDa

€182.00

50ug +182 loyalty points
His Met1–Thr282
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
DNase1-Dockerine chimeric construct(DNASE1)

DNase1-Dockerine chimeric construct(DNASE1)

Product name DNase1-Dockerine chimeric construct(DNASE1)
Uniprot ID P00639
Uniprot link https://www.uniprot.org/uniprot/P00639
Expression system Prokaryotic expression
Raw Antigen Sequence MGKIWLALAGLVLAFSASAGSHHHHHHSGLKIAAFNIRTFGETKMSNATLASYIVRIVRRYDIVLIQEVRDSHLVAVGKLLDYLNQDDPNTYHYVVSEPLGRNSYKERYLFLFRPNKVSVLDTYQYDDGCESCGNDSFSREPAVVKFSSHSTKVKEFAIVALHSAPSDAVAEINSLYDVYLDVQQKWHLNDVMLMGDFNADCSYVTSSQWSSIRLRTSSTFQWLIPDSADTTATSTNCAYDRIVVAGSLLQSSVVPGSAAPFDFQAAYGLSNEMALAISDHYPVEVTLTGPGTKLVPTWGDTNCDGVVNVADVVVLNRFLNDPTYSNITDQGKVNADVVDPQDKSGAAVDPAGVKLTVADSEAILKAIVELITLPQ
Molecular weight 41.4kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >80% by SDS-PAGE
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Thr282
Protein Accession P00639
Spec:Entrez GeneID 282217
Spec:SwissProtID Q8MJ27
NCBI Reference P00639
Aliases /Synonyms DNase I, DNL1
Reference PX-P4877
Note For research use only
Molecular Constructor
His Met1–Thr282
Product name DNase1-Dockerine chimeric construct(DNASE1)
Uniprot ID P00639
Uniprot link https://www.uniprot.org/uniprot/P00639
Expression system Prokaryotic expression
Raw Antigen Sequence MGKIWLALAGLVLAFSASAGSHHHHHHSGLKIAAFNIRTFGETKMSNATLASYIVRIVRRYDIVLIQEVRDSHLVAVGKLLDYLNQDDPNTYHYVVSEPLGRNSYKERYLFLFRPNKVSVLDTYQYDDGCESCGNDSFSREPAVVKFSSHSTKVKEFAIVALHSAPSDAVAEINSLYDVYLDVQQKWHLNDVMLMGDFNADCSYVTSSQWSSIRLRTSSTFQWLIPDSADTTATSTNCAYDRIVVAGSLLQSSVVPGSAAPFDFQAAYGLSNEMALAISDHYPVEVTLTGPGTKLVPTWGDTNCDGVVNVADVVVLNRFLNDPTYSNITDQGKVNADVVDPQDKSGAAVDPAGVKLTVADSEAILKAIVELITLPQ
Molecular weight 41.4kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >80% by SDS-PAGE
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Thr282
Protein Accession P00639
Spec:Entrez GeneID 282217
Spec:SwissProtID Q8MJ27
NCBI Reference P00639
Aliases /Synonyms DNase I, DNL1
Reference PX-P4877
Note For research use only
Molecular Constructor
His Met1–Thr282

There are no reviews yet.

Be the first to review “DNase1-Dockerine chimeric construct(DNASE1)”

Your email address will not be published. Required fields are marked *

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products