Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

? Special Offer?Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

? New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Galectin-9(LGALS9)

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
O00182-2
Molecular weight:
61.76kDa

210.00

50ug +210 loyalty points
Fc Ala2–Thr323
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Galectin-9(LGALS9)

Product name Galectin-9(LGALS9)
Uniprot ID O00182-2
Uniprot link https://www.uniprot.org/uniprot/O00182
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence AFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYI SFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAV DGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT
Molecular weight 61.76kDa
Protein delivered with Tag? N-terminal Fc Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala2-Thr323
Protein Accession O00182
Spec:Entrez GeneID 3965
Spec:NCBI Gene Aliases HUAT; LGALS9A
Spec:SwissProtID Q3B8N1
NCBI Reference O00182
Aliases /Synonyms LGALS9、Medium, Gal-9delta5、D5,Gal-9、Ecalectin、Tumor antigen HOM-HD-21
Reference PX-P4585
Note For research use only
Molecular Constructor
Fc Ala2–Thr323
Product name Galectin-9(LGALS9)
Uniprot ID O00182-2
Uniprot link https://www.uniprot.org/uniprot/O00182
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence AFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYI SFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAV DGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT
Molecular weight 61.76kDa
Protein delivered with Tag? N-terminal Fc Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala2-Thr323
Protein Accession O00182
Spec:Entrez GeneID 3965
Spec:NCBI Gene Aliases HUAT; LGALS9A
Spec:SwissProtID Q3B8N1
NCBI Reference O00182
Aliases /Synonyms LGALS9、Medium, Gal-9delta5、D5,Gal-9、Ecalectin、Tumor antigen HOM-HD-21
Reference PX-P4585
Note For research use only
Molecular Constructor
Fc Ala2–Thr323

There are no reviews yet.

Be the first to review “Galectin-9(LGALS9)”

Your email address will not be published. Required fields are marked *

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products