Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

? Special Offer?Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

? New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Glycogen synthase kinase-3 beta(GSK3B)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P49841
Molecular weight:
47kDa

182.00

50ug +182 loyalty points
GST Met1–Thr420
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Glycogen synthase kinase-3 beta(GSK3B)

Product name Glycogen synthase kinase-3 beta(GSK3B)
Uniprot ID P49841
Uniprot link https://www.uniprot.org/uniprot/P49841
Expression system Prokaryotic expression
Raw Antigen Sequence MAGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST
Molecular weight 47kDa
Protein delivered with Tag? N-terminal GST Tag
Purity estimated >15% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Thr420
Protein Accession P49841
Spec:Entrez GeneID 2932
Spec:SwissProtID Q9BWH3
NCBI Reference P49841
Aliases /Synonyms GSK-3 beta,Serine/threonine-protein kinase GSK3B
Reference PX-P4662
Note For research use only
Molecular Constructor
GST Met1–Thr420
Product name Glycogen synthase kinase-3 beta(GSK3B)
Uniprot ID P49841
Uniprot link https://www.uniprot.org/uniprot/P49841
Expression system Prokaryotic expression
Raw Antigen Sequence MAGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST
Molecular weight 47kDa
Protein delivered with Tag? N-terminal GST Tag
Purity estimated >15% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Thr420
Protein Accession P49841
Spec:Entrez GeneID 2932
Spec:SwissProtID Q9BWH3
NCBI Reference P49841
Aliases /Synonyms GSK-3 beta,Serine/threonine-protein kinase GSK3B
Reference PX-P4662
Note For research use only
Molecular Constructor
GST Met1–Thr420

There are no reviews yet.

Be the first to review “Glycogen synthase kinase-3 beta(GSK3B)”

Your email address will not be published. Required fields are marked *

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products