Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

? Special Offer?Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

? New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Growth/differentiation factor 9(GDF9)

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
O60383
Molecular weight:
15.49 kDa

122.00

100ug +122 loyalty points
His Gly320–Arg454
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Growth/differentiation factor 9(GDF9)

Product name Growth/differentiation factor 9(GDF9)
Uniprot ID O60383
Uniprot link https://www.uniprot.org/uniprot/O60383
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence GQETVSSELKKPLGPASFNLSEYFRQFLLPQNECELHDFRLSFSQLKWDNWIVAPHRYNPRYCKGDCPRAVG HRYGSPVHTMVQNIIYEKLDSSVPRPSCVPAKYSPLSVLTIEPDGSIAYKEYEDMIATKCTCR
Molecular weight 15.49 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly320-Arg454
Protein Accession O60383
Spec:Entrez GeneID 2661
Spec:NCBI Gene Aliases POF14
Spec:SwissProtID Q4VAW5
NCBI Reference O60383
Aliases /Synonyms GDF-9
Reference PX-P4783
Note For research use only
Molecular Constructor
His Gly320–Arg454
Product name Growth/differentiation factor 9(GDF9)
Uniprot ID O60383
Uniprot link https://www.uniprot.org/uniprot/O60383
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence GQETVSSELKKPLGPASFNLSEYFRQFLLPQNECELHDFRLSFSQLKWDNWIVAPHRYNPRYCKGDCPRAVG HRYGSPVHTMVQNIIYEKLDSSVPRPSCVPAKYSPLSVLTIEPDGSIAYKEYEDMIATKCTCR
Molecular weight 15.49 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly320-Arg454
Protein Accession O60383
Spec:Entrez GeneID 2661
Spec:NCBI Gene Aliases POF14
Spec:SwissProtID Q4VAW5
NCBI Reference O60383
Aliases /Synonyms GDF-9
Reference PX-P4783
Note For research use only
Molecular Constructor
His Gly320–Arg454

There are no reviews yet.

Be the first to review “Growth/differentiation factor 9(GDF9)”

Your email address will not be published. Required fields are marked *

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products