Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

? Special Offer?Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

? New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Human Aggrecan (17-360) Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q6PID9
Molecular weight:
40,17 kDa

210.00

50ug +210 loyalty points
Partial Yes
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human Aggrecan (17-360) Recombinant Protein

Product name Human Aggrecan (17-360) Recombinant Protein
Uniprot ID Q6PID9
Uniprot link http://www.uniprot.org/uniprot/Q6PID9
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MAHNHRHKHKLDDDDKAVTVETSDHDNSLSVSIPQPSPLRVLLGTSLTIPCYFIDPMHPVTTAPSTAPLAPRIKWSRVSK EKEVVLLVATEGRVRVNSAYQDKVSLPNYPAIPSDATLEVQSLRSNDSGVYRCEVMHGIEDSEATLEVVVKGIVFHYRAI STRYTLDFDRAQRACLQNSAIIATPEQLQAAYEDGFHQCDAGWLADQTVRYPIHTPREGCYGDKDEFPGVRTYGIRDTNE TYDVYCFAEEMEGEVFYATSPEKFTFQEAANECRRLGARLATTGQLYLAWQAGMDMCSAGWLADRSVRYPISKARPNCGG NLLGVRTVYVHANQTGYPDPSSRYDAICYTGEDFVDIPEN
Molecular weight 40,17 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, imidazole 400mM, Urea 6M, pH8 in denaturing conditions. In native conditions : PBS, DTT 1mM, pH7.4
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AAH36445.1
Spec:SwissProtID Q6PID9
NCBI Reference AAH36445.1
Aliases /Synonyms Aggrecan [17-360], Aggrecan
Reference PX-P1068
Note For research use only
Molecular Constructor
Partial Yes
Product name Human Aggrecan (17-360) Recombinant Protein
Uniprot ID Q6PID9
Uniprot link http://www.uniprot.org/uniprot/Q6PID9
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MAHNHRHKHKLDDDDKAVTVETSDHDNSLSVSIPQPSPLRVLLGTSLTIPCYFIDPMHPVTTAPSTAPLAPRIKWSRVSK EKEVVLLVATEGRVRVNSAYQDKVSLPNYPAIPSDATLEVQSLRSNDSGVYRCEVMHGIEDSEATLEVVVKGIVFHYRAI STRYTLDFDRAQRACLQNSAIIATPEQLQAAYEDGFHQCDAGWLADQTVRYPIHTPREGCYGDKDEFPGVRTYGIRDTNE TYDVYCFAEEMEGEVFYATSPEKFTFQEAANECRRLGARLATTGQLYLAWQAGMDMCSAGWLADRSVRYPISKARPNCGG NLLGVRTVYVHANQTGYPDPSSRYDAICYTGEDFVDIPEN
Molecular weight 40,17 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, imidazole 400mM, Urea 6M, pH8 in denaturing conditions. In native conditions : PBS, DTT 1mM, pH7.4
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AAH36445.1
Spec:SwissProtID Q6PID9
NCBI Reference AAH36445.1
Aliases /Synonyms Aggrecan [17-360], Aggrecan
Reference PX-P1068
Note For research use only
Molecular Constructor
Partial Yes

There are no reviews yet.

Be the first to review “Human Aggrecan (17-360) Recombinant Protein”

Your email address will not be published. Required fields are marked *

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products