Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

? Special Offer?Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

? New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Human Casq2 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
O14958
Molecular weight:
44,72 kDa

210.00

50ug +210 loyalty points
Partial No
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human Casq2 Recombinant Protein

Product name Human Casq2 Recombinant Protein
Uniprot ID O14958
Uniprot link http://www.uniprot.org/uniprot/O14958
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MGSSHHHHHHSSGLVPRGSHMEEGLNFPTYDGKDRVVSLSEKNFKQVLKKYDLLCLYYHEPVSSDKVTQKQFQLKEIVLE LVAQVLEHKAIGFVMVDAKKEAKLAKKLGFDEEGSLYILKGDRTIEFDGEFAADVLVEFLLDLIEDPVEIISSKLEVQAF ERIEDYIKLIGFFKSEDSEYYKAFEEAAEHFQPYIKFFATFDKGVAKKLSLKMNEVDFYEPFMDEPIAIPNKPYTEEELV EFVKEHQRPTLRRLRPEEMFETWEDDLNGIHIVAFAEKSDPDGYEFLEILKQVARDNTDNPDLSILWIDPDDFPLLVAYW EKTFKIDLFRPQIGVVNVTDADSVWMEIPDDDDLPTAEELEDWIEDVLSGKINTEDDDEDDDDDDC
Molecular weight 44,72 kDa
Protein delivered with Tag? No
Purity estimated >95%
Buffer HEPES 10mM, KCl 80mM, NaCl 80 mM, pH 7.4 if cleavage. PBS, imidazole 400mM if elution
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession NP_001223.2
Spec:Entrez GeneID 845
Spec:NCBI Gene Aliases PDIB2
Spec:SwissProtID O14958
NCBI Reference NP_001223.2
Aliases /Synonyms Casq2, calsequestrin-2 precursor
Reference PX-P1078
Note For research use only
Molecular Constructor
Partial No
Product name Human Casq2 Recombinant Protein
Uniprot ID O14958
Uniprot link http://www.uniprot.org/uniprot/O14958
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MGSSHHHHHHSSGLVPRGSHMEEGLNFPTYDGKDRVVSLSEKNFKQVLKKYDLLCLYYHEPVSSDKVTQKQFQLKEIVLE LVAQVLEHKAIGFVMVDAKKEAKLAKKLGFDEEGSLYILKGDRTIEFDGEFAADVLVEFLLDLIEDPVEIISSKLEVQAF ERIEDYIKLIGFFKSEDSEYYKAFEEAAEHFQPYIKFFATFDKGVAKKLSLKMNEVDFYEPFMDEPIAIPNKPYTEEELV EFVKEHQRPTLRRLRPEEMFETWEDDLNGIHIVAFAEKSDPDGYEFLEILKQVARDNTDNPDLSILWIDPDDFPLLVAYW EKTFKIDLFRPQIGVVNVTDADSVWMEIPDDDDLPTAEELEDWIEDVLSGKINTEDDDEDDDDDDC
Molecular weight 44,72 kDa
Protein delivered with Tag? No
Purity estimated >95%
Buffer HEPES 10mM, KCl 80mM, NaCl 80 mM, pH 7.4 if cleavage. PBS, imidazole 400mM if elution
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession NP_001223.2
Spec:Entrez GeneID 845
Spec:NCBI Gene Aliases PDIB2
Spec:SwissProtID O14958
NCBI Reference NP_001223.2
Aliases /Synonyms Casq2, calsequestrin-2 precursor
Reference PX-P1078
Note For research use only
Molecular Constructor
Partial No

There are no reviews yet.

Be the first to review “Human Casq2 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products