Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

? Special Offer?Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

? New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Human CD28 recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P10747
Molecular weight:
42.63kDa

210.00

50ug +210 loyalty points
Partial Yes
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD28 recombinant protein

Product name Human CD28 recombinant protein
Uniprot ID P10747
Uniprot link http://www.uniprot.org/uniprot/P10747
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPDKTHTCPPCPAPELLGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGK
Molecular weight 42.63kDa
Protein delivered with Tag? Yes
Purity estimated 70%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms CD28, T-cell-specific surface glycoprotein CD28, Tp44, T-Cell-Specific Surface Glycoprotein, MGC138290
Reference PX-P4044
Note For research use only
Molecular Constructor
Partial Yes
Product name Human CD28 recombinant protein
Uniprot ID P10747
Uniprot link http://www.uniprot.org/uniprot/P10747
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPDKTHTCPPCPAPELLGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGK
Molecular weight 42.63kDa
Protein delivered with Tag? Yes
Purity estimated 70%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms CD28, T-cell-specific surface glycoprotein CD28, Tp44, T-Cell-Specific Surface Glycoprotein, MGC138290
Reference PX-P4044
Note For research use only
Molecular Constructor
Partial Yes

General Information about Human CD28 recombinant protein

CD28 (Cluster of differentiation 28) is a disulfide-linked glycoprotein which belongs to the immunoglobulin (Ig) superfamily. It consists of a single Ig V-like extracellular domain, transmembrane domain and intracellular domain in the structure. composition. Mouse CD28 is structurally expressed on the surface of all parietal cells and is expressed by developing thymocytes into disulfide-bound homodimers or monomers. CD28 can bind to B7-1 and B7-2 ligands and together play an important role in T and B lymphocyte response. Members of the B7 / CD28 family can enhance or antagonize T cell receptor signal transduction and tolerance of peripheral cells according to central regulation. Thus, CD28 is involved in the activation of T cells, the induction of cell proliferation, the production of cytokines and the acceleration of T cell survival.

There are no reviews yet.

Be the first to review “Human CD28 recombinant protein”

Your email address will not be published. Required fields are marked *

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products