Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

? Special Offer?Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

? New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Human CD80, B7-1 recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P33681
Molecular weight:
28.52kDa

210.00

50ug +210 loyalty points
Partial Yes
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD80, B7-1 recombinant protein

Product name Human CD80, B7-1 recombinant protein
Uniprot ID P33681
Uniprot link http://www.uniprot.org/uniprot/P33681
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNGSHHHHHH
Molecular weight 28.52kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms CD80, CD28LG, CD28LG1, BB1, B7-1 Antigen, T-lymphocyte activation antigen CD80, CTLA-4 counter-receptor B7.1
Reference PX-P4040
Note For research use only
Molecular Constructor
Partial Yes
Product name Human CD80, B7-1 recombinant protein
Uniprot ID P33681
Uniprot link http://www.uniprot.org/uniprot/P33681
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNGSHHHHHH
Molecular weight 28.52kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms CD80, CD28LG, CD28LG1, BB1, B7-1 Antigen, T-lymphocyte activation antigen CD80, CTLA-4 counter-receptor B7.1
Reference PX-P4040
Note For research use only
Molecular Constructor
Partial Yes

General Information about Human CD80/B7-1 recombinant protein

Cluster of Differentiation 80 (CD80/B7-1), recombinant human protein is supplied as a lyophilized powder. It is suitable for analysis of protein structure, investigation of protein-protein interactions, and specific biological research applications. It can also be used as an immunogen or protein standard.

There are no reviews yet.

Be the first to review “Human CD80, B7-1 recombinant protein”

Your email address will not be published. Required fields are marked *

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products