Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

? Special Offer?Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

? New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Human HMGB1 extracellular recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P09429
Molecular weight:
26.97kDa

210.00

50ug +210 loyalty points
Full-length Yes
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human HMGB1 extracellular recombinant protein

Product name Human HMGB1 extracellular recombinant protein
Uniprot ID P09429
Uniprot link http://www.uniprot.org/uniprot/P09429
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MGSHHHHHHSGLEVLFQGPMGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE
Molecular weight 26.97kDa
Protein delivered with Tag? Yes
Purity estimated 85%
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Full-length
Spec:Entrez GeneID 3146
Aliases /Synonyms Amphoterin, Chromosomal protein, nonhistone, HMG1, DKFZp686A04236, High mobility group 1, High mobility group box 1, High mobility group protein 1, High mobility group protein B1, high-mobility group (nonhistone chromosomal) protein 1, HMG-1, HMG1, HMG3, HMGB 1, HMGB1, HMGB1_HUMAN, NONHISTONE CHROMOSOMAL PROTEIN HMG1, SBP 1, Sulfoglucuronyl carbohydrate binding protein
Reference PX-P4002
Note For research use only
Molecular Constructor
Full-length Yes
Product name Human HMGB1 extracellular recombinant protein
Uniprot ID P09429
Uniprot link http://www.uniprot.org/uniprot/P09429
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MGSHHHHHHSGLEVLFQGPMGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE
Molecular weight 26.97kDa
Protein delivered with Tag? Yes
Purity estimated 85%
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Full-length
Spec:Entrez GeneID 3146
Aliases /Synonyms Amphoterin, Chromosomal protein, nonhistone, HMG1, DKFZp686A04236, High mobility group 1, High mobility group box 1, High mobility group protein 1, High mobility group protein B1, high-mobility group (nonhistone chromosomal) protein 1, HMG-1, HMG1, HMG3, HMGB 1, HMGB1, HMGB1_HUMAN, NONHISTONE CHROMOSOMAL PROTEIN HMG1, SBP 1, Sulfoglucuronyl carbohydrate binding protein
Reference PX-P4002
Note For research use only
Molecular Constructor
Full-length Yes

There are no reviews yet.

Be the first to review “Human HMGB1 extracellular recombinant protein”

Your email address will not be published. Required fields are marked *

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products