Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

? Special Offer?Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

? New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Human IL6 Recombinant Protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P05231
Molecular weight:
49.8 kDa

€170.00

20ug +170 loyalty points
Full-length
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Human IL6 Recombinant Protein binds to Siltuximab Biosimilar – Anti-IL6 mAb in indirect ELISA assay

Human IL6 Recombinant Protein

Product name Human IL6 Recombinant Protein
Uniprot ID P05231
Uniprot link http://www.uniprot.org/uniprot/P05231
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQMDDDDKDKTHTCPPCPAPELLGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGK
Molecular weight 49.8 kDa
Purity estimated 95%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Full-length
NCBI Reference P05231
Aliases /Synonyms Interleukin 6, IL-6, MGI2-A, MGI2A, HGF, BSF2, HSF, IFNB2, B-Cell Stimulatory Factor-2, B-cell stimulatory factor 2, Hybridoma/Plasmacytoma Growth Factor proteins, Hepatocyte Stimulating Factor, Cytotoxic T-Cell Differentiation Factor,CTL differentiation factor, CDF, Hybridoma Growth Factor proteins,Interferon beta-2,IFN-beta-2,BSF-2
Reference PX-P3013
Note For research use only
Molecular Constructor
Full-length
Product name Human IL6 Recombinant Protein
Uniprot ID P05231
Uniprot link http://www.uniprot.org/uniprot/P05231
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQMDDDDKDKTHTCPPCPAPELLGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGK
Molecular weight 49.8 kDa
Purity estimated 95%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Full-length
NCBI Reference P05231
Aliases /Synonyms Interleukin 6, IL-6, MGI2-A, MGI2A, HGF, BSF2, HSF, IFNB2, B-Cell Stimulatory Factor-2, B-cell stimulatory factor 2, Hybridoma/Plasmacytoma Growth Factor, Hepatocyte Stimulating Factor, Cytotoxic T-Cell Differentiation Factor,CTL differentiation factor, CDF, Hybridoma growth factor,Interferon beta-2,IFN-beta-2,BSF-2
Reference PX-P3013
Note For research use only
Molecular Constructor
Full-length
Product name Human IL6 Recombinant Protein
Uniprot ID P05231
Uniprot link http://www.uniprot.org/uniprot/P05231
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQMDDDDKDKTHTCPPCPAPELLGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGK
Molecular weight 49.8 kDa
Purity estimated 95%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Full-length
NCBI Reference P05231
Aliases /Synonyms Interleukin 6, IL-6, MGI2-A, MGI2A, HGF, BSF2, HSF, IFNB2, B-Cell Stimulatory Factor-2, B-cell stimulatory factor 2, Hybridoma/Plasmacytoma Growth Factor proteins, Hepatocyte Stimulating Factor, Cytotoxic T-Cell Differentiation Factor,CTL differentiation factor, CDF, Hybridoma Growth Factor proteins,Interferon beta-2,IFN-beta-2,BSF-2
Reference PX-P3013
Note For research use only
Molecular Constructor
Full-length

Human IL6 Recombinant Protein binds to Siltuximab Biosimilar – Anti-IL6 mAb in indirect ELISA assay

Human IL6 Recombinant Protein binds to Siltuximab Biosimilar – Anti-IL6 mAb in indirect ELISA assay

  • Breton J, La Fiura A, Bertolero F, Orsini G, Valsasina B, Ziliotto R, De Filippis V, Polverino de Laureto P, Fontana A. Structure, stability and biological properties of a N-terminally truncated form of recombinant human interleukin-6 containing a single disulfide bond. Eur J Biochem. 1995 Jan 15;227(1-2):573-81. PubMed PMID: 7851440.

There are no reviews yet.

Be the first to review “Human IL6 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products