Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

? Special Offer?Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

? New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Human PAFAH-LpPLA2-PLA2G7 recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q13093 
Molecular weight:
50.94kDa

210.00

50ug +210 loyalty points
Full-length Yes
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human PAFAH-LpPLA2-PLA2G7 recombinant protein

Product name Human PAFAH-LpPLA2-PLA2G7 recombinant protein
Uniprot ID Q13093 
Uniprot link http://www.uniprot.org/uniprot/Q13093 
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MVPPKLHVLFCLCGCLAVVYPFDWQYINPVAHMKSSAWVNKIQVLMAAASFGQTKIPRGNGPYSVGCTDLMFDHTNKGTF LRLYYPSQDNDRLDTLWIPNKEYFWGLSKFLGTHWLMGNILRLLFGSMTTPANWNSPLRPGEKYPLVVFSHGLGAFRTLY SAIGIDLASHGFIVAAVEHRDRSASATYYFKDQSAAEIGDKSWLYLRTLKQEEETHIRNEQVRQRAKECSQALSLILDID HGKPVKNALDLKFDMEQLKDSIDREKIAVIGHSFGGATVIQTLSEDQRFRCGIALDAWMFPLGDEVYSRIPQPLFFINSE YFQYPANIIKMKKCYSPDKERKMITIRGSVHQNFADFTFATGKIIGHMLKLKGDIDSNAAIDLSNKASLAFLQKHLGLHK DFDQWDCLIEGDDENLIPGTNINTTNQHIMLQNSSGIEKYNGSHHHHHH
Molecular weight 50.94kDa
Protein delivered with Tag? Yes
Purity estimated 50%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Full-length
Aliases /Synonyms PLA2G7, PAF-AH, PAFAH, Lp-PLA2, LDL-PLA2, Platelet Activating Factor Acetylhydrolase,Plasma, Phospholipase A2,Group VII, LDL-associated phospholipase A2
Reference PX-P4061
Note For research use only
Molecular Constructor
Full-length Yes
Product name Human PAFAH-LpPLA2-PLA2G7 recombinant protein
Uniprot ID Q13093 
Uniprot link http://www.uniprot.org/uniprot/Q13093 
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MVPPKLHVLFCLCGCLAVVYPFDWQYINPVAHMKSSAWVNKIQVLMAAASFGQTKIPRGNGPYSVGCTDLMFDHTNKGTF LRLYYPSQDNDRLDTLWIPNKEYFWGLSKFLGTHWLMGNILRLLFGSMTTPANWNSPLRPGEKYPLVVFSHGLGAFRTLY SAIGIDLASHGFIVAAVEHRDRSASATYYFKDQSAAEIGDKSWLYLRTLKQEEETHIRNEQVRQRAKECSQALSLILDID HGKPVKNALDLKFDMEQLKDSIDREKIAVIGHSFGGATVIQTLSEDQRFRCGIALDAWMFPLGDEVYSRIPQPLFFINSE YFQYPANIIKMKKCYSPDKERKMITIRGSVHQNFADFTFATGKIIGHMLKLKGDIDSNAAIDLSNKASLAFLQKHLGLHK DFDQWDCLIEGDDENLIPGTNINTTNQHIMLQNSSGIEKYNGSHHHHHH
Molecular weight 50.94kDa
Protein delivered with Tag? Yes
Purity estimated 50%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Full-length
Aliases /Synonyms PLA2G7, PAF-AH, PAFAH, Lp-PLA2, LDL-PLA2, Platelet Activating Factor Acetylhydrolase,Plasma, Phospholipase A2,Group VII, LDL-associated phospholipase A2
Reference PX-P4061
Note For research use only
Molecular Constructor
Full-length Yes

General Information about Human PAFAH/ LpPLA2/PLA2G7 recombinant protein

Lipoprotein-related phospholipase A2 (Lp-PLA2), also known as platelet activating factor acetyl hydrolase (PAF-AH), is a phospholipase A2 enzyme, which is encoded by the PLA2G7 gene in humans. Lp-PLA2 is a 45 kD protein of 441 amino acids. It is one of several PAF acetyl hydrolase enzymes. Lp-PLA2 is carried mainly with low-density lipoprotein (LDL) in the blood. Less than 20% are related to HDL. Several tests have shown that HDL-related Lp-PLA2 can significantly promote the anti-cancer effects of HDL. It is an enzyme produced by inflammatory cells that can hydrolyze oxidized phospholipids in LDL. Lp-PLA2 is a platelet activation factor (PAF) acetyl hydrolase, a secreted enzyme that can catalyze the degradation of PAF in inactive products by hydrolyzing the acetyl group at the sn-2 position, producing biologically inert products LYSO-PAF and acetate. Lp-PLA2 is involved in the development of atherosclerosis, and this discovery has aroused interest as a potential therapeutic target. In human atherosclerotic lesions, two main sources of Lp-PLA2 can be identified, including the source of LDL-binding intolerance (through the circulation) and the source of de novo synthesis of inflammatory plaque cells (Macrophages, T cells, mast cells). It is used as a marker of heart disease.

There are no reviews yet.

Be the first to review “Human PAFAH-LpPLA2-PLA2G7 recombinant protein”

Your email address will not be published. Required fields are marked *

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products