Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

? Special Offer?Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

? New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Human Trans-3-hydroxy-L-proline dehydratase Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q96EM0
Molecular weight:
40,05 kDa

210.00

50ug +210 loyalty points
Full-length Yes
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human Trans-3-hydroxy-L-proline dehydratase Recombinant Protein

Product name Human Trans-3-hydroxy-L-proline dehydratase Recombinant Protein
Uniprot ID Q96EM0
Uniprot link http://www.uniprot.org/uniprot/Q96EM0
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MAHNHRHKHKLDDDDKMESALAVPRLPPHDPGTPVLSVVDMHTGGEPLRIVLAGCPEVSGPTLLAKRRYMRQHLDHVRRR LMFEPRGHRDMYGAVLVPSELPDAHLGVLFLHNEGYSSMCGHAVLALGRFALDFGLVPAPPAGTREARVNIHCPCGLVTA FVACEDGRSHGPVRFHSVPAFVLATDLMVDVPGHGKVMVDIAYGGAFYAFVTAEKLGLDICSAKTRDLVDAASAVTEAVK AQFKINHPDSEDLAFLYGTILTDGKDAYTKEPTTNICVFADEQVDRSPTGSGVTARIALQYHKGLLELNQMRAFKSSATG SVFTGKAVREAKCGDFKAVIVEVSGQAHYTGTASFIIEDDDPLRDGFLLK
Molecular weight 40,05 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, imidazole 300mM, pH7.4 if native conditions. PBS, imidazole 10mM, Urea 8M if denaturing conditions
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession NP_653182.1
Spec:Entrez GeneID 112849
Spec:NCBI Gene Aliases C14orf149
Spec:SwissProtID Q96EM0
NCBI Reference NP_653182.1
Aliases /Synonyms ORF149, trans-L-3-hydroxyproline dehydratase (Former Proline racemase)
Reference PX-P1134
Note For research use only
Molecular Constructor
Full-length Yes
Product name Human Trans-3-hydroxy-L-proline dehydratase Recombinant Protein
Uniprot ID Q96EM0
Uniprot link http://www.uniprot.org/uniprot/Q96EM0
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MAHNHRHKHKLDDDDKMESALAVPRLPPHDPGTPVLSVVDMHTGGEPLRIVLAGCPEVSGPTLLAKRRYMRQHLDHVRRR LMFEPRGHRDMYGAVLVPSELPDAHLGVLFLHNEGYSSMCGHAVLALGRFALDFGLVPAPPAGTREARVNIHCPCGLVTA FVACEDGRSHGPVRFHSVPAFVLATDLMVDVPGHGKVMVDIAYGGAFYAFVTAEKLGLDICSAKTRDLVDAASAVTEAVK AQFKINHPDSEDLAFLYGTILTDGKDAYTKEPTTNICVFADEQVDRSPTGSGVTARIALQYHKGLLELNQMRAFKSSATG SVFTGKAVREAKCGDFKAVIVEVSGQAHYTGTASFIIEDDDPLRDGFLLK
Molecular weight 40,05 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, imidazole 300mM, pH7.4 if native conditions. PBS, imidazole 10mM, Urea 8M if denaturing conditions
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession NP_653182.1
Spec:Entrez GeneID 112849
Spec:NCBI Gene Aliases C14orf149
Spec:SwissProtID Q96EM0
NCBI Reference NP_653182.1
Aliases /Synonyms ORF149, trans-L-3-hydroxyproline dehydratase (Former Proline racemase)
Reference PX-P1134
Note For research use only
Molecular Constructor
Full-length Yes

There are no reviews yet.

Be the first to review “Human Trans-3-hydroxy-L-proline dehydratase Recombinant Protein”

Your email address will not be published. Required fields are marked *

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products