Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

? Special Offer?Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

? New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Human Tumor necrosis factor receptor superfamily member 1A (TNFR1A) recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P19438
Molecular weight:
24.35kDa

210.00

50ug +210 loyalty points
Partial
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human Tumor necrosis factor receptor superfamily member 1A (TNFR1A) recombinant protein

Product name Human Tumor necrosis factor receptor superfamily member 1A (TNFR1A) recombinant protein
Uniprot ID P19438
Uniprot link http://www.uniprot.org/uniprot/P19438
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTTGSHHHHHH
Molecular weight 24.35kDa
Purity estimated 90%
Buffer 50 mM Tris-HCl pH 8, 150 mM NaCl
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms CD120A, P55, TBP1, FPF, TNF-R, TNF-R-I, TNF-R55, TNFAR, TNFR1, TNFR55, TNFR60, P55-R, P60, Tumor necrosis factor receptor 1, Tumor necrosis factor-binding protein 1
Reference PX-P4037
Note For research use only
Molecular Constructor
Partial
Product name Human Tumor necrosis factor receptor superfamily member 1A (TNFR1A) recombinant protein
Uniprot ID P19438
Uniprot link http://www.uniprot.org/uniprot/P19438
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTTGSHHHHHH
Molecular weight 24.35kDa
Purity estimated 90%
Buffer 50 mM Tris-HCl pH 8, 150 mM NaCl
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms CD120A, P55, TBP1, FPF, TNF-R, TNF-R-I, TNF-R55, TNFAR, TNFR1, TNFR55, TNFR60, P55-R, P60, Tumor necrosis factor receptor 1, Tumor necrosis factor-binding protein 1
Reference PX-P4037
Note For research use only
Molecular Constructor
Partial

There are no reviews yet.

Be the first to review “Human Tumor necrosis factor receptor superfamily member 1A (TNFR1A) recombinant protein”

Your email address will not be published. Required fields are marked *

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products