Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

? Special Offer?Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

? New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

ICOSL Protein- Human ICOS ligand recombinant protein- CD278 Protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
O75144
Molecular weight:
29.56kDa

210.00

50ug +210 loyalty points
Partial Yes
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

ICOSL Protein- Human ICOS ligand recombinant protein- CD278 Protein

Product name ICOSL Protein- Human ICOS ligand recombinant protein- CD278 Protein
Uniprot ID O75144
Uniprot link http://www.uniprot.org/uniprot/O75144
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSGSHHHHHH
Molecular weight 29.56kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer 50 mM Tris-HCl pH 8, 150 mM NaCl
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition

ICOSL protein is stored:


At 4°C for short term period (less than a week)
At -20°C or -80°C for long term period

Recommendations


It is important to avoid avoid freezing/thawing cycles
20-40% glycerol may be added to improve cryoprotection
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms CD275, B7-H2, B7H2, B7RP-1, B7RP1, GL50, ICOS-L, ICOSL, LICOS, B7-like protein Gl50, B7-related protein 1
Reference PX-P4032
Note For research use only
Molecular Constructor
Partial Yes
Product name ICOSL Protein- Human ICOS ligand recombinant protein- CD278 Protein
Uniprot ID O75144
Uniprot link http://www.uniprot.org/uniprot/O75144
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSGSHHHHHH
Molecular weight 29.56kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer 50 mM Tris-HCl pH 8, 150 mM NaCl
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition

ICOSL protein is stored:


At 4°C for short term period (less than a week)
At -20°C or -80°C for long term period

Recommendations


It is important to avoid avoid freezing/thawing cycles
20-40% glycerol may be added to improve cryoprotection
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms CD275, B7-H2, B7H2, B7RP-1, B7RP1, GL50, ICOS-L, ICOSL, LICOS, B7-like protein Gl50, B7-related protein 1
Reference PX-P4032
Note For research use only
Molecular Constructor
Partial Yes

SDS-PAGE for ICOSL Protein- Human ICOS ligand recombinant protein- CD278 Protein

SDS-PAGE for ICOSL Protein- Human ICOS ligand recombinant protein- CD278 Protein

ICOSL Protein- Human ICOS ligand recombinant protein- CD278 Protein, on SDS-PAGE under reducing

There are no reviews yet.

Be the first to review “ICOSL Protein- Human ICOS ligand recombinant protein- CD278 Protein”

Your email address will not be published. Required fields are marked *

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products