Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

? Special Offer?Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

? New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Interleukin-27 subunit beta(EBI3)&Interleukin-12 subunit alpha(IL12A)

Host species:
Mammalian cells
Uniprot ID:
Q14213&P29459
Molecular weight:
74.4kDa

210.00

50ug +210 loyalty points
Met1–Lys229 Q14213) & Arg23-Ser219(P29459 Fc
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Interleukin-27 subunit beta(EBI3)&Interleukin-12 subunit alpha(IL12A)

Product name Interleukin-27 subunit beta(EBI3)&Interleukin-12 subunit alpha(IL12A)
Uniprot ID Q14213&P29459
Uniprot link https://www.uniprot.org/uniprot/P29459
Expression system Eukaryotic expression
Raw Antigen Sequence MTPQLLLALVLWASCPPCSGRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGKGGGGSGGGGSGGGGSRNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Molecular weight 74.4kDa
Protein delivered with Tag? C-terminal Fc Tag
Purity estimated >85% by SDS-PAGE
Buffer PBS, pH7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Lys229(Q14213) & Arg23-Ser219(P29459)
Protein Accession Q14213&P29459
Spec:Entrez GeneID 10148&3592
Spec:NCBI Gene Aliases IL27B; IL35B; IL-27B,P35; CLMF; NFSK; NKSF1; IL-12A
Spec:SwissProtID Q14213&P29459
NCBI Reference Q14213&P29459
Aliases /Synonyms IL-27 subunit beta,IL-27B,Epstein-Barr virus-induced gene 3 protein,EBV-induced gene 3 protein,IL27B & IL-12A,Cytotoxic lymphocyte maturation factor 35 kDa subunit,CLMF p35,IL-12 subunit p35,NK cell stimulatory factor chain 1,NKSF1,NKSF1
Reference PX-P4678
Note For research use only
Molecular Constructor
Met1–Lys229 Q14213) & Arg23-Ser219(P29459 Fc
Product name Interleukin-27 subunit beta(EBI3)&Interleukin-12 subunit alpha(IL12A)
Uniprot ID Q14213&P29459
Uniprot link https://www.uniprot.org/uniprot/P29459
Expression system Eukaryotic expression
Raw Antigen Sequence MTPQLLLALVLWASCPPCSGRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGKGGGGSGGGGSGGGGSRNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Molecular weight 74.4kDa
Protein delivered with Tag? C-terminal Fc Tag
Purity estimated >85% by SDS-PAGE
Buffer PBS, pH7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Lys229(Q14213) & Arg23-Ser219(P29459)
Protein Accession Q14213&P29459
Spec:Entrez GeneID 10148&3592
Spec:NCBI Gene Aliases IL27B; IL35B; IL-27B,P35; CLMF; NFSK; NKSF1; IL-12A
Spec:SwissProtID Q14213&P29459
NCBI Reference Q14213&P29459
Aliases /Synonyms IL-27 subunit beta,IL-27B,Epstein-Barr virus-induced gene 3 protein,EBV-induced gene 3 protein,IL27B & IL-12A,Cytotoxic lymphocyte maturation factor 35 kDa subunit,CLMF p35,IL-12 subunit p35,NK cell stimulatory factor chain 1,NKSF1,NKSF1
Reference PX-P4678
Note For research use only
Molecular Constructor
Met1–Lys229 Q14213) & Arg23-Ser219(P29459 Fc

There are no reviews yet.

Be the first to review “Interleukin-27 subunit beta(EBI3)&Interleukin-12 subunit alpha(IL12A)”

Your email address will not be published. Required fields are marked *

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products