Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

? Special Offer?Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

? New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Interleukin-7(IL7)

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P13232
Molecular weight:
17.45kDa

182.00

50ug +182 loyalty points
Asp26–His177 His
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Interleukin-7(IL7)

Product name Interleukin-7(IL7)
Uniprot ID P13232
Uniprot link https://www.uniprot.org/uniprot/P13232
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
Molecular weight 17.45kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >80% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp26-His177
Protein Accession P13232
Spec:Entrez GeneID 3574
Spec:NCBI Gene Aliases IL-7
Spec:SwissProtID A0N0L3
NCBI Reference P13232
Reference PX-P4559
Note For research use only
Molecular Constructor
Asp26–His177 His
Product name Interleukin-7(IL7)
Uniprot ID P13232
Uniprot link https://www.uniprot.org/uniprot/P13232
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
Molecular weight 17.45kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >80% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp26-His177
Protein Accession P13232
Spec:Entrez GeneID 3574
Spec:NCBI Gene Aliases IL-7
Spec:SwissProtID A0N0L3
NCBI Reference P13232
Reference PX-P4559
Note For research use only
Molecular Constructor
Asp26–His177 His

There are no reviews yet.

Be the first to review “Interleukin-7(IL7)”

Your email address will not be published. Required fields are marked *

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products