Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

? Special Offer?Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

? New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Lipolysis-stimulated lipoprotein receptor(LSR)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
Q86X29
Molecular weight:
13.5kDa

210.00

50ug +210 loyalty points
His Met431–Ser540
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Lipolysis-stimulated lipoprotein receptor(LSR)

Product name Lipolysis-stimulated lipoprotein receptor(LSR)
Uniprot ID Q86X29
Uniprot link https://www.uniprot.org/uniprot/Q86X29
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGMSEVTSLHEDDWRSRPSRGPALTPIRDEEWGGHSPRSPRGWDQEPAREQAGGGWRARRPRARSVDALDD LTPPSTAESGSRSPTSNGGRSRAYMPPRSRSRDDLYDQDDS
Molecular weight 13.5kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met431-Ser540
Protein Accession Q86X29
Spec:Entrez GeneID 51599
Spec:NCBI Gene Aliases ILDR3; LISCH7
Spec:SwissProtID Q6ZT80
NCBI Reference Q86X29
Aliases /Synonyms LISCH
Reference PX-P4845
Note For research use only
Molecular Constructor
His Met431–Ser540
Product name Lipolysis-stimulated lipoprotein receptor(LSR)
Uniprot ID Q86X29
Uniprot link https://www.uniprot.org/uniprot/Q86X29
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGMSEVTSLHEDDWRSRPSRGPALTPIRDEEWGGHSPRSPRGWDQEPAREQAGGGWRARRPRARSVDALDD LTPPSTAESGSRSPTSNGGRSRAYMPPRSRSRDDLYDQDDS
Molecular weight 13.5kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met431-Ser540
Protein Accession Q86X29
Spec:Entrez GeneID 51599
Spec:NCBI Gene Aliases ILDR3; LISCH7
Spec:SwissProtID Q6ZT80
NCBI Reference Q86X29
Aliases /Synonyms LISCH
Reference PX-P4845
Note For research use only
Molecular Constructor
His Met431–Ser540

There are no reviews yet.

Be the first to review “Lipolysis-stimulated lipoprotein receptor(LSR)”

Your email address will not be published. Required fields are marked *

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products