Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

? Special Offer?Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

? New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Meiotic recombination protein REC8 homolog(Rec8)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
Q8C5S7
Molecular weight:
67.42kDa

210.00

50ug +210 loyalty points
GST Met1–Pro591
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Meiotic recombination protein REC8 homolog(Rec8)

Product name Meiotic recombination protein REC8 homolog(Rec8)
Uniprot ID Q8C5S7
Uniprot link https://www.uniprot.org/uniprot/Q8C5S7
Expression system Prokaryotic expression
Raw Antigen Sequence MFYYPNVLQRHTGCFATIWLAATRGSRLVKREYLNVNVVKTCEEILNYVLVRVQPPVAGLPRPRFSLYLSAQLQIGVIRVYFQQCQYLVEDIQHILEHLHRAQLRIRIDMEEADLPSLLLPNCLAMMETLEDAPEPFFGKMSVDPRLPSPFDIPQIRHLLEAATPEKTRKETLPEATPDPRKPDRTLATVQSPEVITLQEAEPIRMLQIEGEQDLPEISRGDLELLIAEKDDAILLEERQRGRLLRQRRASLPLDESREEPRALEGAGLVSALSPPAPAQVEGIQEALPGQVFPPEVQKMTGWEPGALLTEVTPPQELRLPAPPSTEKRLPSLQRPLPRRHRRRQLLFWDKETQISREKFEEQLQTGAHCWEYPVAQPPKRMLTSPAELFRTPTLSGWLPPELLGLWTHCAQVPQRMLRQRPQLETEETVEEERAADEEERRKTEALSEIEVLREAQEPSGPLMLSSELSLEAAEDEKSRTSLIPPEWWAWSEEGQPEPPALPMLPELPEVPMEMPPRPELSSEAVLRAVALKLQANKELDFSSLVPPLSPRKLASRVFY LLLVLSTQKILLVEQQKPYGPLLIRPGPKFP
Molecular weight 67.42kDa
Protein delivered with Tag? N-terminal GST Tag
Purity estimated >80% by SDS-PAGE
Buffer TBS, pH8.0
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Pro591
Protein Accession Q8C5S7
Spec:Entrez GeneID 56739
Spec:NCBI Gene Aliases mre; mrec; Rec8L1
Spec:SwissProtID Q3UIN9
NCBI Reference Q8C5S7
Aliases /Synonyms Cohesin Rec8p,Mei8, Rec8L1
Reference PX-P4828
Note For research use only
Molecular Constructor
GST Met1–Pro591
Product name Meiotic recombination protein REC8 homolog(Rec8)
Uniprot ID Q8C5S7
Uniprot link https://www.uniprot.org/uniprot/Q8C5S7
Expression system Prokaryotic expression
Raw Antigen Sequence MFYYPNVLQRHTGCFATIWLAATRGSRLVKREYLNVNVVKTCEEILNYVLVRVQPPVAGLPRPRFSLYLSAQLQIGVIRVYFQQCQYLVEDIQHILEHLHRAQLRIRIDMEEADLPSLLLPNCLAMMETLEDAPEPFFGKMSVDPRLPSPFDIPQIRHLLEAATPEKTRKETLPEATPDPRKPDRTLATVQSPEVITLQEAEPIRMLQIEGEQDLPEISRGDLELLIAEKDDAILLEERQRGRLLRQRRASLPLDESREEPRALEGAGLVSALSPPAPAQVEGIQEALPGQVFPPEVQKMTGWEPGALLTEVTPPQELRLPAPPSTEKRLPSLQRPLPRRHRRRQLLFWDKETQISREKFEEQLQTGAHCWEYPVAQPPKRMLTSPAELFRTPTLSGWLPPELLGLWTHCAQVPQRMLRQRPQLETEETVEEERAADEEERRKTEALSEIEVLREAQEPSGPLMLSSELSLEAAEDEKSRTSLIPPEWWAWSEEGQPEPPALPMLPELPEVPMEMPPRPELSSEAVLRAVALKLQANKELDFSSLVPPLSPRKLASRVFY LLLVLSTQKILLVEQQKPYGPLLIRPGPKFP
Molecular weight 67.42kDa
Protein delivered with Tag? N-terminal GST Tag
Purity estimated >80% by SDS-PAGE
Buffer TBS, pH8.0
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Pro591
Protein Accession Q8C5S7
Spec:Entrez GeneID 56739
Spec:NCBI Gene Aliases mre; mrec; Rec8L1
Spec:SwissProtID Q3UIN9
NCBI Reference Q8C5S7
Aliases /Synonyms Cohesin Rec8p,Mei8, Rec8L1
Reference PX-P4828
Note For research use only
Molecular Constructor
GST Met1–Pro591

There are no reviews yet.

Be the first to review “Meiotic recombination protein REC8 homolog(Rec8)”

Your email address will not be published. Required fields are marked *

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products