Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

? Special Offer?Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

? New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Mouse BRP-39 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
House Mouse
Uniprot ID:
Q61362
Molecular weight:
42,30 kDa

210.00

50ug +210 loyalty points
Partial Yes
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Mouse BRP-39 Recombinant Protein

Product name Mouse BRP-39 Recombinant Protein
Uniprot ID Q61362
Uniprot link http://www.uniprot.org/uniprot/Q61362
Origin species House Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MAHNHRHKHKLMYKLVCYFTSWSQYREGVGSFLPDAIQPFLCTHIIYSFANISSDNMLSTWEWNDESNYDKLNKLKTRNT NLKTLLSVGGWKFGEKRFSEIASNTERRTAFVRSVAPFLRSYGFDGLDLAWLYPRLRDKQYFSTLIKELNAEFTKEVQPG REKLLLSAALSAGKVAIDTGYDIAQIAQHLDFINLMTYDFHGVWRQITGHHSPLFQGQKDTRFDRYSNVNYAVQYMIRLG AQASKLLMGIPTFGKSFTLASSENQLGAPISGEGLPGRFTKEAGTLAYYEICDFLKGAEVHRLSNEKVPFATKGNQWVGY EHKESVKNKVGFLKEKKLAGAMVWALDLDDFQGTCQPKEFFPLTNAIKDALA
Molecular weight 42,30 kDa
Protein delivered with Tag? Yes
Purity estimated >95%
Buffer PBS, imidazole 10mM, Urea 8M, pH4
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession CAA63603.1
Spec:Entrez GeneID 12654
Spec:NCBI Gene Aliases Brp39, AW208766, Chi3l1, Gp39
Spec:SwissProtID Q61362
NCBI Reference CAA63603.1
Aliases /Synonyms BRP-39, BRP39 protein, Chitinase-3-like protein 1, Chi3l1
Reference PX-P1075
Note For research use only
Molecular Constructor
Partial Yes
Product name Mouse BRP-39 Recombinant Protein
Uniprot ID Q61362
Uniprot link http://www.uniprot.org/uniprot/Q61362
Origin species House Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MAHNHRHKHKLMYKLVCYFTSWSQYREGVGSFLPDAIQPFLCTHIIYSFANISSDNMLSTWEWNDESNYDKLNKLKTRNT NLKTLLSVGGWKFGEKRFSEIASNTERRTAFVRSVAPFLRSYGFDGLDLAWLYPRLRDKQYFSTLIKELNAEFTKEVQPG REKLLLSAALSAGKVAIDTGYDIAQIAQHLDFINLMTYDFHGVWRQITGHHSPLFQGQKDTRFDRYSNVNYAVQYMIRLG AQASKLLMGIPTFGKSFTLASSENQLGAPISGEGLPGRFTKEAGTLAYYEICDFLKGAEVHRLSNEKVPFATKGNQWVGY EHKESVKNKVGFLKEKKLAGAMVWALDLDDFQGTCQPKEFFPLTNAIKDALA
Molecular weight 42,30 kDa
Protein delivered with Tag? Yes
Purity estimated >95%
Buffer PBS, imidazole 10mM, Urea 8M, pH4
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession CAA63603.1
Spec:Entrez GeneID 12654
Spec:NCBI Gene Aliases Brp39, AW208766, Chi3l1, Gp39
Spec:SwissProtID Q61362
NCBI Reference CAA63603.1
Aliases /Synonyms BRP-39, BRP39 protein, Chitinase-3-like protein 1, Chi3l1
Reference PX-P1075
Note For research use only
Molecular Constructor
Partial Yes

There are no reviews yet.

Be the first to review “Mouse BRP-39 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products