Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

? Special Offer?Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

? New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Mouse ENO1 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
House Mouse
Uniprot ID:
P17182
Molecular weight:
50,68 kDa

210.00

50ug +210 loyalty points
Full-length Yes
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Mouse ENO1 Recombinant Protein

Product name Mouse ENO1 Recombinant Protein
Uniprot ID P17182
Uniprot link http://www.uniprot.org/uniprot/P17182
Origin species House Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MGHHHHHHHHHHSSGHIEGRHMMSILRIHAREIFDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDNDKTRFM GKGVSQAVEHINKTIAPALVSKKVNVVEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCKAGAVEKGVPLYRHIADLA GNPEVILPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFREAMRIGAEVYHNLKNVIKEKYGKDATNVGDEGGFAPNIL ENKEALELLKTAIAKAGYTDQVVIGMDVAASEFYRSGKYDLDFKSPDDPSRYITPDQLADLYKSFVQNYPVVSIEDPFDQ DDWGAWQKFTASAGIQVVGDDLTVTNPKRIAKAASEKSCNCLLLKVNQIGSVTESLQACKLAQSNGWGVMVSHRSGETED TFIADLVVGLCTGQIKTGAPCRSERLAKYNQILRIEEELGSKAKFAGRSFRNPLAKDYLDDDDL
Molecular weight 50,68 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession NP_075608
Spec:Entrez GeneID 13806
Spec:NCBI Gene Aliases MBP-1, AL022784, 0610008I15, Eno-1
Spec:SwissProtID P17182
NCBI Reference NP_075608
Aliases /Synonyms ENO1 Protein, Alpha Enolase Protein, Alpha enolase like 1 Protein, ENO1L1 Protein, Enolase 1 Protein, MBP-1 Protein, MBPB1 Protein, MPB1 Protein, MYC promoter-binding protein 1 Protein, NNE Protein, Phosphopyruvate hydratase Protein, Alpha-enolase Protein, Tau-crystallin Protein, MBP1 Protein, MPB-1 Protein, C-myc promoter-binding protein Protein, Enolase 1, (alpha) Protein, Enolase-alpha Protein, Non-neural enolase Protein, Plasminogen-binding protein Protein, PPH Protein
Reference PX-P1088
Note For research use only
Molecular Constructor
Full-length Yes
Product name Mouse ENO1 Recombinant Protein
Uniprot ID P17182
Uniprot link http://www.uniprot.org/uniprot/P17182
Origin species House Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MGHHHHHHHHHHSSGHIEGRHMMSILRIHAREIFDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDNDKTRFM GKGVSQAVEHINKTIAPALVSKKVNVVEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCKAGAVEKGVPLYRHIADLA GNPEVILPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFREAMRIGAEVYHNLKNVIKEKYGKDATNVGDEGGFAPNIL ENKEALELLKTAIAKAGYTDQVVIGMDVAASEFYRSGKYDLDFKSPDDPSRYITPDQLADLYKSFVQNYPVVSIEDPFDQ DDWGAWQKFTASAGIQVVGDDLTVTNPKRIAKAASEKSCNCLLLKVNQIGSVTESLQACKLAQSNGWGVMVSHRSGETED TFIADLVVGLCTGQIKTGAPCRSERLAKYNQILRIEEELGSKAKFAGRSFRNPLAKDYLDDDDL
Molecular weight 50,68 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession NP_075608
Spec:Entrez GeneID 13806
Spec:NCBI Gene Aliases MBP-1, AL022784, 0610008I15, Eno-1
Spec:SwissProtID P17182
NCBI Reference NP_075608
Aliases /Synonyms ENO1 Protein, Alpha Enolase Protein, Alpha enolase like 1 Protein, ENO1L1 Protein, Enolase 1 Protein, MBP-1 Protein, MBPB1 Protein, MPB1 Protein, MYC promoter-binding protein 1 Protein, NNE Protein, Phosphopyruvate hydratase Protein, Alpha-enolase Protein, Tau-crystallin Protein, MBP1 Protein, MPB-1 Protein, C-myc promoter-binding protein Protein, Enolase 1, (alpha) Protein, Enolase-alpha Protein, Non-neural enolase Protein, Plasminogen-binding protein Protein, PPH Protein
Reference PX-P1088
Note For research use only
Molecular Constructor
Full-length Yes

General information on Mouse ENO1 Recombinant Protein:

Enolase 1 (ENO1), commonly known as alpha-enolase is a glycolytic enzyme, one of three enolase isoenzymes found in mammals. Every isoenzyme is a homodimer composed of 2 alpha, 2 gamma, or 2 beta subunits, and functions as a glycolytic enzyme. ENO1 is a glycolytic enzyme that catalyzes the conversion of 2-phosphoglycerate to phosphoenolpyruvate. This isozyme is ubiquitously expressed in adult human tissues, including liver, brain, kidney, and spleen. It is a multifunctional enzyme that plays a part in the glycolysis and in various processes such as growth control, hypoxia tolerance and allergic responses. It can also work in the intravascular and pericellular fibrinolytic system because to its capability to serve as a receptor and activator of plasminogen on the cell surface of several cell-types such as leukocytes and neurons.

  • Guillou C, Derambure C, Fréret M, Verdet M, Avenel G, Golinski ML, Sabourin JC, Le Loarer F, Adriouch S, Boyer O, Lequerré T, Vittecoq O. Prophylactic Injection of Recombinant Alpha-Enolase Reduces Arthritis Severity in the Collagen-Induced Arthritis Mice Model. PLoS One. 2015 Aug 24;10(8):e0136359. doi: 10.1371/journal.pone.0136359. eCollection 2015. PubMed PMID: 26302382; PubMed Central PMCID: PMC4547710.
  • Sousa LP, Silva BM, Brasil BS, Nogueira SV, Ferreira PC, Kroon EG, Kato K, Bonjardim CA. Plasminogen/plasmin regulates alpha-enolase expression through the MEK/ERK pathway. Biochem Biophys Res Commun. 2005 Dec 2;337(4):1065-71. Epub 2005 Oct 4. PubMed PMID: 16225843.
  • Lopez-Alemany R, Suelves M, Diaz-Ramos A, Vidal B, Munoz-Canoves P. Alpha-enolase plasminogen receptor in myogenesis. Front Biosci. 2005 Jan 1;10:30-6. Print 2005 Jan 1. Review. PubMed PMID: 15574344.
  • López-Alemany R, Suelves M, Muñoz-Cánoves P. Plasmin generation dependent on alpha-enolase-type plasminogen receptor is required for myogenesis. Thromb Haemost. 2003 Oct;90(4):724-33. PubMed PMID: 14515195.
  • Couldrey C, Carlton MB, Ferrier J, Colledge WH, Evans MJ. Disruption of murine alpha-enolase by a retroviral gene trap results in early embryonic lethality. Dev Dyn. 1998 Jun;212(2):284-92. PubMed PMID: 9626503.
  • Bottalico LA, Kendrick NC, Keller A, Li Y, Tabas I. Cholesteryl ester loading of mouse peritoneal macrophages is associated with changes in the expression or modification of specific cellular proteins, including increase in an alpha-enolase isoform. Arterioscler Thromb. 1993 Feb;13(2):264-75. PubMed PMID: 8427861.
  • Mutze K, Vierkotten S, Milosevic J, Eickelberg O, Königshoff M. Enolase 1 (ENO1) and protein disulfide-isomerase associated 3 (PDIA3) regulate Wnt/β-catenin-driven trans-differentiation of murine alveolar epithelial cells. Dis Model Mech. 2015 Aug 1;8(8):877-90. doi: 10.1242/dmm.019117. Epub 2015 May 14. PubMed PMID: 26035385; PubMed Central PMCID: PMC4527283.
  • Bae S, Kim H, Lee N, Won C, Kim HR, Hwang YI, Song YW, Kang JS, Lee WJ. α-Enolase expressed on the surfaces of monocytes and macrophages induces robust synovial inflammation in rheumatoid arthritis. J Immunol. 2012 Jul 1;189(1):365-72. doi: 10.4049/jimmunol.1102073. Epub 2012 May 23. PubMed PMID: 22623332.
  • Ryu SY, Hong GU, Kim DY, Ro JY. Enolase 1 and calreticulin regulate the differentiation and function of mouse mast cells. Cell Signal. 2012 Jan;24(1):60-70. doi: 10.1016/j.cellsig.2011.07.011. Epub 2011 Jul 23. PubMed PMID: 21803152.
  • Wang J, Gu Y, Wang L, Hang X, Gao Y, Wang H, Zhang C. HUPO BPP pilot study: a proteomics analysis of the mouse brain of different developmental stages. Proteomics. 2007 Nov;7(21):4008-15. PubMed PMID: 17922513.
  • Keller A, Demeurie J, Merkulova T, Géraud G, Cywiner-Golenzer C, Lucas M, Châtelet FP. Fibre-type distribution and subcellular localisation of alpha and beta enolase in mouse striated muscle. Biol Cell. 2000 Oct;92(7):527-35. PubMed PMID: 11229603.
  • Merkulova T, Lucas M, Jabet C, Lamandé N, Rouzeau JD, Gros F, Lazar M, Keller A. Biochemical characterization of the mouse muscle-specific enolase: developmental changes in electrophoretic variants and selective binding to other proteins. Biochem J. 1997 May 1;323 ( Pt 3):791-800. PubMed PMID: 9169614; PubMed Central PMCID: PMC1218384.
  • Lazar M, Lucas M, Lamandé N, Bishop JG, Gros F, Legault-Demare L. Isolation of murine neuron-specific and non-neuronal enolase cDNA clones. Biochem Biophys Res Commun. 1986 Nov 26;141(1):271-7. PubMed PMID: 3801001.
  • Kaghad M, Dumont X, Chalon P, Lelias JM, Lamandé N, Lucas M, Lazar M, Caput D. Nucleotide sequences of cDNAs alpha and gamma enolase mRNAs from mouse brain. Nucleic Acids Res. 1990 Jun 25;18(12):3638. PubMed PMID: 2362815; PubMed Central PMCID: PMC331026.
  • Barbieri G, De Angelis L, Feo S, Cossu G, Giallongo A. Differential expression of muscle-specific enolase in embryonic and fetal myogenic cells during mouse development. Differentiation. 1990 Dec;45(3):179-84. PubMed PMID: 2090519.

There are no reviews yet.

Be the first to review “Mouse ENO1 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products