Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

? Special Offer?Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

? New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Mucin-4(MUC4)(1869-1925)

Host species:
Insect
Origin species:
Human
Uniprot ID:
Q99102
Molecular weight:
9.55kDa

210.00

50ug +210 loyalty points
Gly1869–Asn1925 His
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Mucin-4(MUC4)(1869-1925)

Product name Mucin-4(MUC4)(1869-1925)
Uniprot ID Q99102
Uniprot link https://www.uniprot.org/uniprot/Q99102
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MESHMLLFLFSLATGLFGAVHGGSSFLCQNQSCPVNYCYNQGHCYISQTLGCQPMCTCPPAFTDSRCFLAGNNFSPTVNSGHHHHHH*
Molecular weight 9.55kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated /
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect
Fragment Type Gly1869-Asn1925
Aliases /Synonyms Ascites sialoglycoprotein,ASGP,Pancreatic adenocarcinoma mucin,Testis mucin,Tracheobronchial mucin
Reference PX-P4275
Note For research use only
Molecular Constructor
Gly1869–Asn1925 His
Product name Mucin-4(MUC4)(1869-1925)
Uniprot ID Q99102
Uniprot link https://www.uniprot.org/uniprot/Q99102
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MESHMLLFLFSLATGLFGAVHGGSSFLCQNQSCPVNYCYNQGHCYISQTLGCQPMCTCPPAFTDSRCFLAGNNFSPTVNSGHHHHHH*
Molecular weight 9.55kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated /
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect
Fragment Type Gly1869-Asn1925
Aliases /Synonyms Ascites sialoglycoprotein,ASGP,Pancreatic adenocarcinoma mucin,Testis mucin,Tracheobronchial mucin
Reference PX-P4275
Note For research use only
Molecular Constructor
Gly1869–Asn1925 His

There are no reviews yet.

Be the first to review “Mucin-4(MUC4)(1869-1925)”

Your email address will not be published. Required fields are marked *

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products