Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

? Special Offer?Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

? New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

NADPH oxidase 4(NOX4) (210-424)

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q9NPH5
Molecular weight:
24.81 kDa

142.00

100ug +142 loyalty points
His Gly210–Glu424
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

NADPH oxidase 4(NOX4) (210-424)

Product name NADPH oxidase 4(NOX4) (210-424)
Uniprot ID Q9NPH5
Uniprot link https://www.uniprot.org/uniprot/Q9NPH5
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence GGLLKYQTNLDTHPPGCISLNRTSSQNISLPEYFSEHFHEPFPEGFSKPAEFTQHKFVKICMEEPRFQANFP QTWLWISGPLCLYCAERLYRYIRSNKPVTIISVISHPSDVMEIRMVKENFKARPGQYITLHCPSVSALENHP FTLTMCPTETKATFGVHLKIVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEESLNYE
Molecular weight 24.81 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly210-Glu424
Protein Accession Q9NPH5
Spec:Entrez GeneID 50507
Spec:NCBI Gene Aliases KOX; KOX-1; RENOX
Spec:SwissProtID Q86V92
NCBI Reference Q9NPH5
Aliases /Synonyms Kidney oxidase-1,KOX-1,Kidney superoxide-producing NADPH oxidase,Renal NAD(P)H-oxidase,RENOX
Reference PX-P4785
Note For research use only
Molecular Constructor
His Gly210–Glu424
Product name NADPH oxidase 4(NOX4) (210-424)
Uniprot ID Q9NPH5
Uniprot link https://www.uniprot.org/uniprot/Q9NPH5
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence GGLLKYQTNLDTHPPGCISLNRTSSQNISLPEYFSEHFHEPFPEGFSKPAEFTQHKFVKICMEEPRFQANFP QTWLWISGPLCLYCAERLYRYIRSNKPVTIISVISHPSDVMEIRMVKENFKARPGQYITLHCPSVSALENHP FTLTMCPTETKATFGVHLKIVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEESLNYE
Molecular weight 24.81 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly210-Glu424
Protein Accession Q9NPH5
Spec:Entrez GeneID 50507
Spec:NCBI Gene Aliases KOX; KOX-1; RENOX
Spec:SwissProtID Q86V92
NCBI Reference Q9NPH5
Aliases /Synonyms Kidney oxidase-1,KOX-1,Kidney superoxide-producing NADPH oxidase,Renal NAD(P)H-oxidase,RENOX
Reference PX-P4785
Note For research use only
Molecular Constructor
His Gly210–Glu424

There are no reviews yet.

Be the first to review “NADPH oxidase 4(NOX4) (210-424)”

Your email address will not be published. Required fields are marked *

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products