Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

? Special Offer?Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

? New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Phosphatidylinositol 3-kinase regulatory subunit alpha(PIK3R1)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P27986
Molecular weight:
11.8kDa

210.00

50ug +210 loyalty points
Trp624–Val718 His
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Phosphatidylinositol 3-kinase regulatory subunit alpha(PIK3R1)

Product name Phosphatidylinositol 3-kinase regulatory subunit alpha(PIK3R1)
Uniprot ID P27986
Uniprot link https://www.uniprot.org/uniprot/P27986
Expression system Prokaryotic expression
Raw Antigen Sequence MWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVLEHHHHHH
Molecular weight 11.8kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >80% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Trp624-Val718
Protein Accession P27986
Spec:Entrez GeneID 5295
Spec:NCBI Gene Aliases p85; AGM7; GRB1; IMD36; p85-ALPHA
Spec:SwissProtID Q15747
NCBI Reference P27986
Aliases /Synonyms PI3-kinase regulatory subunit alpha,PI3K regulatory subunit alpha,PtdIns-3-kinase regulatory subunit alpha,Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha,PI3-kinase subunit p85-alpha,PtdIns-3-kinase regulatory subunit p85-alpha,GRB1
Reference PX-P4850
Note For research use only
Molecular Constructor
Trp624–Val718 His
Product name Phosphatidylinositol 3-kinase regulatory subunit alpha(PIK3R1)
Uniprot ID P27986
Uniprot link https://www.uniprot.org/uniprot/P27986
Expression system Prokaryotic expression
Raw Antigen Sequence MWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVLEHHHHHH
Molecular weight 11.8kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >80% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Trp624-Val718
Protein Accession P27986
Spec:Entrez GeneID 5295
Spec:NCBI Gene Aliases p85; AGM7; GRB1; IMD36; p85-ALPHA
Spec:SwissProtID Q15747
NCBI Reference P27986
Aliases /Synonyms PI3-kinase regulatory subunit alpha,PI3K regulatory subunit alpha,PtdIns-3-kinase regulatory subunit alpha,Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha,PI3-kinase subunit p85-alpha,PtdIns-3-kinase regulatory subunit p85-alpha,GRB1
Reference PX-P4850
Note For research use only
Molecular Constructor
Trp624–Val718 His

There are no reviews yet.

Be the first to review “Phosphatidylinositol 3-kinase regulatory subunit alpha(PIK3R1)”

Your email address will not be published. Required fields are marked *

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products