Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

? Special Offer?Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

? New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Rabies virus Nucleoprotein Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Rabies virus
Uniprot ID:
Q0PNB8
Molecular weight:
51.58 kDa

210.00

50ug +210 loyalty points
Full-length Yes
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Rabies virus Nucleoprotein Recombinant Protein

Product name Rabies virus Nucleoprotein Recombinant Protein
Uniprot ID Q0PNB8
Uniprot link http://www.uniprot.org/uniprot/Q0PNB8
Origin species Rabies virus
Expression system Eukaryotic expression
Raw Antigen Sequence MDADKIVFRVNNQVVSLKPEIIVDQYEYKYPAIKDLKKPSITLGKAPDLNKAYKSVLSGMNAAKLDPDDVCSYLAAAMQFFEGTCPEDWNSYGILIARKGDKITPDSLVDIKRTDVEGNWALTGGMELTRDPTVSEHASLVGLLLSLYRLSKISGQNTGNYKTNIADRIEQIFETAPFVKIVEHHTLMTTHKMCANWSTIPNFRFLAGTYDMFFSRIEHLYSAIRVGTVVTAYEDCSGLVSFTGFIKQINLTAKEAILYFFHKNFEEEIRRMFEPGQETAVPHSYFIHFRSLGLSGKSPYSSNAVGHVFNLIHFVGCYMGQVRSLNATVIAACAPHEMSVLGGYLGEEFFGKGTFERRFFRDEKELQEYEAAELTKTDLALADDGTVNSDDEDYFSGETRSPEAVYTRIMMNGGRLKRSHIRRYVSVSSNHQARPNSFAEFLNKTYSSDSGSHHHHHH
Molecular weight 51.58 kDa
Protein delivered with Tag? Yes
Purity estimated 85%
Buffer Tris-HC 50mMl, NaCl 150mM, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect
Fragment Type Full-length
NCBI Reference Q0PNB8
Aliases /Synonyms Nucleoprotein
Reference PX-P3020
Note For research use only
Molecular Constructor
Full-length Yes
Product name Rabies virus Nucleoprotein Recombinant Protein
Uniprot ID Q0PNB8
Uniprot link http://www.uniprot.org/uniprot/Q0PNB8
Origin species Rabies virus
Expression system Eukaryotic expression
Raw Antigen Sequence MDADKIVFRVNNQVVSLKPEIIVDQYEYKYPAIKDLKKPSITLGKAPDLNKAYKSVLSGMNAAKLDPDDVCSYLAAAMQFFEGTCPEDWNSYGILIARKGDKITPDSLVDIKRTDVEGNWALTGGMELTRDPTVSEHASLVGLLLSLYRLSKISGQNTGNYKTNIADRIEQIFETAPFVKIVEHHTLMTTHKMCANWSTIPNFRFLAGTYDMFFSRIEHLYSAIRVGTVVTAYEDCSGLVSFTGFIKQINLTAKEAILYFFHKNFEEEIRRMFEPGQETAVPHSYFIHFRSLGLSGKSPYSSNAVGHVFNLIHFVGCYMGQVRSLNATVIAACAPHEMSVLGGYLGEEFFGKGTFERRFFRDEKELQEYEAAELTKTDLALADDGTVNSDDEDYFSGETRSPEAVYTRIMMNGGRLKRSHIRRYVSVSSNHQARPNSFAEFLNKTYSSDSGSHHHHHH
Molecular weight 51.58 kDa
Protein delivered with Tag? Yes
Purity estimated 85%
Buffer Tris-HC 50mMl, NaCl 150mM, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect
Fragment Type Full-length
NCBI Reference Q0PNB8
Aliases /Synonyms Nucleoprotein
Reference PX-P3020
Note For research use only
Molecular Constructor
Full-length Yes

General information on Rabies virus Nucleoprotein Recombinant Protein

Rabies rabies virus (a species of the Rhabdoviridae family), formerly a rabies virus, is a neurological virus that causes rabies in humans and animals. Rabies virus is an RNA virus wrapped in green or unidirectional, negative, non-secreting. Genomic anger codes for five proteins: nuclear protein (N), phosphoprotein (P), matrix protein (M), glycoprotein (G) and polymerase (L). It has two important structural components: the spiral core of ribonucleoprotein (RNP) and the lipoprotein envelope surrounded by the spiny thorns of glycoprotein (G).

There are no reviews yet.

Be the first to review “Rabies virus Nucleoprotein Recombinant Protein”

Your email address will not be published. Required fields are marked *

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products