Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

? Special Offer?Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

? New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Receptor tyrosine-protein kinase erbB-3(ERBB3)His Tag

Host species:
Mammalian cells
Uniprot ID:
P21860
Molecular weight:
71.67 kDa

210.00

50ug +210 loyalty points
Met1–Thr643 His
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Receptor tyrosine-protein kinase erbB-3(ERBB3)His Tag

Product name Receptor tyrosine-protein kinase erbB-3(ERBB3)His Tag
Uniprot ID P21860
Uniprot link https://www.uniprot.org/uniprot/P21860
Expression system Eukaryotic expression
Raw Antigen Sequence MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILS GGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVA SCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGNLDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGGRSLYNRGFSLLI MKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEERLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEPREFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQC AHFRDGPHCVSSCPHGVLGAKGPIYKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLTGSHHHHHH
Molecular weight 71.67 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Thr643
Protein Accession P21860
Spec:Entrez GeneID 2065
Spec:NCBI Gene Aliases HER3; FERLK; LCCS2; ErbB-3; c-erbB3; erbB3-S; MDA-BF-1; c-erbB-3; p180-ErbB3; p45-sErbB3; p85-sErbB3
Spec:SwissProtID Q9BUD7
NCBI Reference P21860
Aliases /Synonyms Proto-oncogene-like protein c-ErbB-3,Tyrosine kinase-type cell surface receptor HER3,HER3
Reference PX-P4724
Note For research use only
Molecular Constructor
Met1–Thr643 His
Product name Receptor tyrosine-protein kinase erbB-3(ERBB3)His Tag
Uniprot ID P21860
Uniprot link https://www.uniprot.org/uniprot/P21860
Expression system Eukaryotic expression
Raw Antigen Sequence MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILS GGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVA SCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGNLDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGGRSLYNRGFSLLI MKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEERLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEPREFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQC AHFRDGPHCVSSCPHGVLGAKGPIYKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLTGSHHHHHH
Molecular weight 71.67 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Thr643
Protein Accession P21860
Spec:Entrez GeneID 2065
Spec:NCBI Gene Aliases HER3; FERLK; LCCS2; ErbB-3; c-erbB3; erbB3-S; MDA-BF-1; c-erbB-3; p180-ErbB3; p45-sErbB3; p85-sErbB3
Spec:SwissProtID Q9BUD7
NCBI Reference P21860
Aliases /Synonyms Proto-oncogene-like protein c-ErbB-3,Tyrosine kinase-type cell surface receptor HER3,HER3
Reference PX-P4724
Note For research use only
Molecular Constructor
Met1–Thr643 His

Lumretuzumab Biosimilar – Anti-ERBB3 mAb – Research Grade binds to Receptor tyrosine-protein kinase erbB-3(ERBB3)His Tag in indirect ELISA Assay

Lumretuzumab Biosimilar – Anti-ERBB3 mAb – Research Grade binds to Receptor tyrosine-protein kinase erbB-3(ERBB3)His Tag in indirect ELISA Assay

Immobilized Receptor tyrosine-protein kinase erbB-3(ERBB3)His Tag (cat. No.PX-P4724) at 0.5µg/mL (100µL/well) can bind to Lumretuzumab Biosimilar – Anti-ERBB3 mAb – Research Grade (cat. No. PX-TA1357) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

There are no reviews yet.

Be the first to review “Receptor tyrosine-protein kinase erbB-3(ERBB3)His Tag”

Your email address will not be published. Required fields are marked *

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products