Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

? Special Offer?Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

? New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Ribonucleoside-diphosphate reductase subunit M2 B(RRM2B)

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q7LG56
Molecular weight:
40.74 kDa

142.00

100ug +142 loyalty points
Met1–Phe351 N terminus His
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Ribonucleoside-diphosphate reductase subunit M2 B(RRM2B)

Product name Ribonucleoside-diphosphate reductase subunit M2 B(RRM2B)
Uniprot ID Q7LG56
Uniprot link https://www.uniprot.org/uniprot/Q7LG56
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MGDPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLS KDLPHWNKLKADEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDT YIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGVFFSGSFAAIFWLKKRGLMPG LTFSNELISRDEGLHCDFACLMFQYLVNKPSEERVREIIVDAVKIEQEFLTEALPVGLIGMNCILMKQYIEF VADRLLVELGFSKVFQAENPFDFMENISLEGKTNFFEKRVSEYQRFAVMAETTDNVFTLDADF
Molecular weight 40.74 kDa
Protein delivered with Tag? N terminus His tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Phe351
Protein Accession Q7LG56
Spec:Entrez GeneID 50484
Spec:NCBI Gene Aliases P53R2; MTDPS8A; MTDPS8B
Spec:SwissProtID Q17RZ6
NCBI Reference Q7LG56
Aliases /Synonyms TP53-inducible ribonucleotide reductase M2 B,p53-inducible ribonucleotide reductase small subunit 2-like protein,p53R2,P53R2
Reference PX-P4793
Note For research use only
Molecular Constructor
Met1–Phe351 N terminus His
Product name Ribonucleoside-diphosphate reductase subunit M2 B(RRM2B)
Uniprot ID Q7LG56
Uniprot link https://www.uniprot.org/uniprot/Q7LG56
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MGDPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLS KDLPHWNKLKADEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDT YIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGVFFSGSFAAIFWLKKRGLMPG LTFSNELISRDEGLHCDFACLMFQYLVNKPSEERVREIIVDAVKIEQEFLTEALPVGLIGMNCILMKQYIEF VADRLLVELGFSKVFQAENPFDFMENISLEGKTNFFEKRVSEYQRFAVMAETTDNVFTLDADF
Molecular weight 40.74 kDa
Protein delivered with Tag? N terminus His tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Phe351
Protein Accession Q7LG56
Spec:Entrez GeneID 50484
Spec:NCBI Gene Aliases P53R2; MTDPS8A; MTDPS8B
Spec:SwissProtID Q17RZ6
NCBI Reference Q7LG56
Aliases /Synonyms TP53-inducible ribonucleotide reductase M2 B,p53-inducible ribonucleotide reductase small subunit 2-like protein,p53R2,P53R2
Reference PX-P4793
Note For research use only
Molecular Constructor
Met1–Phe351 N terminus His

There are no reviews yet.

Be the first to review “Ribonucleoside-diphosphate reductase subunit M2 B(RRM2B)”

Your email address will not be published. Required fields are marked *

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products