Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

? Special Offer?Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

? New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Synthetic construction GST 26-1 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
synthetic construction
Uniprot ID:
P08515
Molecular weight:
39.38kDa

210.00

50ug +210 loyalty points
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Synthetic construction GST 26-1 Recombinant Protein

Product name Synthetic construction GST 26-1 Recombinant Protein
Uniprot ID P08515
Uniprot link https://www.uniprot.org/uniprot/P08515
Origin species synthetic construction
Expression system Prokaryotic expression
Raw Antigen Sequence MATQHIVGDDKGWALGVDYVAWANARQIVQGDELVFNYDVKGDFPVFYTTKDKFERCCPYGALMELANTGHNVVTLGGVGDYYFIPKGVDCKQNMKLHVNVKASPALQEGRNAILAGSLEVLFQGPHMSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPE
Molecular weight 39.38kDa
Purity estimated 70%
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Spec:SwissProtID P08515
NCBI Reference ABS19453
Aliases /Synonyms GST 26-1 (Sta1)
Reference PX-P2092
Note For research use only
Product name Synthetic construction GST 26-1 Recombinant Protein
Uniprot ID P08515
Uniprot link https://www.uniprot.org/uniprot/P08515
Origin species synthetic construction
Expression system Prokaryotic expression
Raw Antigen Sequence MATQHIVGDDKGWALGVDYVAWANARQIVQGDELVFNYDVKGDFPVFYTTKDKFERCCPYGALMELANTGHNVVTLGGVGDYYFIPKGVDCKQNMKLHVNVKASPALQEGRNAILAGSLEVLFQGPHMSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPE
Molecular weight 39.38kDa
Purity estimated 70%
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Spec:SwissProtID P08515
NCBI Reference ABS19453
Aliases /Synonyms GST 26-1 (Sta1)
Reference PX-P2092
Note For research use only

There are no reviews yet.

Be the first to review “Synthetic construction GST 26-1 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products