Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

? Special Offer?Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

? New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Thioredoxin 1(trxA) (Escherichia coli)

Origin species:
Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Uniprot ID:
P0AA26

122.00

100ug +122 loyalty points
Met1–Ala110 His
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Thioredoxin 1(trxA) (Escherichia coli)

Product name Thioredoxin 1(trxA) (Escherichia coli)
Uniprot ID P0AA26
Uniprot link https://www.uniprot.org/uniprot/P0AA26
Origin species Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Expression system Prokaryotic expression
Raw Antigen Sequence MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLALEHHHHHH
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Fragment Type Met1-Ala110
Protein Accession P0AA26
Spec:SwissProtID Q8XAT2
NCBI Reference P0AA26
Aliases /Synonyms Trx-1
Reference PX-P4691
Note For research use only
Molecular Constructor
Met1–Ala110 His
Product name Thioredoxin 1(trxA) (Escherichia coli)
Uniprot ID P0AA26
Uniprot link https://www.uniprot.org/uniprot/P0AA26
Origin species Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Expression system Prokaryotic expression
Raw Antigen Sequence MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLALEHHHHHH
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Fragment Type Met1-Ala110
Protein Accession P0AA26
Spec:SwissProtID Q8XAT2
NCBI Reference P0AA26
Aliases /Synonyms Trx-1
Reference PX-P4691
Note For research use only
Molecular Constructor
Met1–Ala110 His

There are no reviews yet.

Be the first to review “Thioredoxin 1(trxA) (Escherichia coli)”

Your email address will not be published. Required fields are marked *

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products