Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

? Special Offer?Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

? New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Thymic stromal lymphopoietin(TSLP)

Host species:
Mammalian cells
Uniprot ID:
Q969D9
Molecular weight:
18.2kDa

210.00

50ug +210 loyalty points
Tyr29–Gln159 His
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Thymic stromal lymphopoietin(TSLP)

Product name Thymic stromal lymphopoietin(TSLP)
Uniprot ID Q969D9
Uniprot link https://www.uniprot.org/uniprot/Q969D9
Expression system Eukaryotic expression
Raw Antigen Sequence MKHLWFFLLLVAAPRWVLSYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQGSHHHHHH
Molecular weight 18.2kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >70% by SDS-PAGE
Buffer PBS, pH7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Tyr29-Gln159
Protein Accession Q969D9
Spec:Entrez GeneID 85480
Spec:SwissProtID Q8IW99
NCBI Reference Q969D9
Aliases /Synonyms Thymic stromal lymphopoietin
Reference PX-P4679
Note For research use only
Molecular Constructor
Tyr29–Gln159 His
Product name Thymic stromal lymphopoietin(TSLP)
Uniprot ID Q969D9
Uniprot link https://www.uniprot.org/uniprot/Q969D9
Expression system Eukaryotic expression
Raw Antigen Sequence MKHLWFFLLLVAAPRWVLSYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQGSHHHHHH
Molecular weight 18.2kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >70% by SDS-PAGE
Buffer PBS, pH7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Tyr29-Gln159
Protein Accession Q969D9
Spec:Entrez GeneID 85480
Spec:SwissProtID Q8IW99
NCBI Reference Q969D9
Aliases /Synonyms Thymic stromal lymphopoietin
Reference PX-P4679
Note For research use only
Molecular Constructor
Tyr29–Gln159 His

There are no reviews yet.

Be the first to review “Thymic stromal lymphopoietin(TSLP)”

Your email address will not be published. Required fields are marked *

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products