Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

? Special Offer?Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

? New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Tomato Le_eIFiso4E Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Tomato
Uniprot ID:
A7Y4C8
Molecular weight:
23,95 kDa

210.00

50ug +210 loyalty points
Full-length Yes
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Tomato Le_eIFiso4E Recombinant Protein

Product name Tomato Le_eIFiso4E Recombinant Protein
Uniprot ID A7Y4C8
Uniprot link http://www.uniprot.org/uniprot/A7Y4C8
Origin species Tomato
Expression system Prokaryotic expression
Raw Antigen Sequence MSGHHHHHHAMATEAPVEATEIPSVAAAETVEKQPHKLERKWTFWFDNQSKPKQGVAWGSSLRKAYTFETVEEFWSLYDQ IFKPSKVTVNADFHLFKAGIEPKWEDPECANGGKWTATSSRKANLETMWLETLMALVGEQFDESEDICGVVASVRRSQDK LSLWTKTATNEAAQMGIGRKWKEIIDAEKISYSFHDDSKRERSAKSRYTV
Molecular weight 23,95 kDa
Protein delivered with Tag? Yes
Purity estimated >95%
Buffer PBS, Urea 8M, imidazole 10mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession NP_001234772.1
Spec:Entrez GeneID 100134893
Spec:SwissProtID A7Y4C8
NCBI Reference NP_001234772.1
Aliases /Synonyms Le_eIFiso4E, eukaryotic translation initiation factor iso4E
Reference PX-P1120
Note For research use only
Molecular Constructor
Full-length Yes
Product name Tomato Le_eIFiso4E Recombinant Protein
Uniprot ID A7Y4C8
Uniprot link http://www.uniprot.org/uniprot/A7Y4C8
Origin species Tomato
Expression system Prokaryotic expression
Raw Antigen Sequence MSGHHHHHHAMATEAPVEATEIPSVAAAETVEKQPHKLERKWTFWFDNQSKPKQGVAWGSSLRKAYTFETVEEFWSLYDQ IFKPSKVTVNADFHLFKAGIEPKWEDPECANGGKWTATSSRKANLETMWLETLMALVGEQFDESEDICGVVASVRRSQDK LSLWTKTATNEAAQMGIGRKWKEIIDAEKISYSFHDDSKRERSAKSRYTV
Molecular weight 23,95 kDa
Protein delivered with Tag? Yes
Purity estimated >95%
Buffer PBS, Urea 8M, imidazole 10mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession NP_001234772.1
Spec:Entrez GeneID 100134893
Spec:SwissProtID A7Y4C8
NCBI Reference NP_001234772.1
Aliases /Synonyms Le_eIFiso4E, eukaryotic translation initiation factor iso4E
Reference PX-P1120
Note For research use only
Molecular Constructor
Full-length Yes

There are no reviews yet.

Be the first to review “Tomato Le_eIFiso4E Recombinant Protein”

Your email address will not be published. Required fields are marked *

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products