Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

? Special Offer?Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

? New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Xaa-Pro aminopeptidase 2(XPNPEP2)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
O43895
Molecular weight:
72.1kDa

182.00

50ug +182 loyalty points
Gly21–Ala650 His
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Xaa-Pro aminopeptidase 2(XPNPEP2)

Product name Xaa-Pro aminopeptidase 2(XPNPEP2)
Uniprot ID O43895
Uniprot link https://www.uniprot.org/uniprot/O43895
Expression system Prokaryotic expression
Raw Antigen Sequence MGHTKPVDLGGQDVRNCSTNPPYLPVTVVNTTMSLTALRQQMQTQNLSAYIIPGTDAHMNEYIGQHDERRAWITGFTGSAGTAVVTMKKAAVWTDSRYWTQAERQMDCNWELHKEVGTTPIVTWLLTEIPAGGRVGFDPFLLSIDTWESYDLALQGSNRQLVSITTNLVDLVWGSERPPVPNQPIYALQEAFTGSTWQEKVSGVRSQMQKHQKVPTAVLLSALEETAWLFNLRASDIPYNPFFYSYTLLTDSSIRLFANKSRFSSETLSYLNSSCTGPMCVQIEDYSQVRDSIQAYSLGDVRIWIGTSYTMYGIYEMIPKEKLVTDTYSPVMMTKAVKNSKEQALLKASHVRDAVAVIRYLVWLEKNVPKGTVDEFSGAEIVDKFRGEEQFSSGPSFETISASGLNAALAHYSPTKELNRKLSSDEMYLLDSGGQYWDGTTDITRTVHWGTPSAFQKEAYTRVLIGNIDLSRLIFPAATSGRMVEAFARRALWDAGLNYGHGTGHGIGNFLCVHEWPVGFQSNNIAMAKGMFTSIEPGYYKDGEFGIRLEDVALVVEAKTKYPGSYLTFEVVSFVPYDRNLIDVSLLSPEHLQYLNRYYQTIREKVGPELQRRQLLEEFEWLQQHTEPLAALEHHHHHH
Molecular weight 72.1kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >15% by SDS-PAGE
Buffer PBS,pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly21-Ala650
Protein Accession O43895
Spec:Entrez GeneID 7512
Spec:NCBI Gene Aliases APP2; AEACEI
Spec:SwissProtID O75994
NCBI Reference O43895
Aliases /Synonyms Aminoacylproline aminopeptidase,Membrane-bound aminopeptidase P,Membrane-bound APP,Membrane-bound AmP,mAmP,X-Pro aminopeptidase 2
Reference PX-P4837
Note For research use only
Molecular Constructor
Gly21–Ala650 His
Product name Xaa-Pro aminopeptidase 2(XPNPEP2)
Uniprot ID O43895
Uniprot link https://www.uniprot.org/uniprot/O43895
Expression system Prokaryotic expression
Raw Antigen Sequence MGHTKPVDLGGQDVRNCSTNPPYLPVTVVNTTMSLTALRQQMQTQNLSAYIIPGTDAHMNEYIGQHDERRAWITGFTGSAGTAVVTMKKAAVWTDSRYWTQAERQMDCNWELHKEVGTTPIVTWLLTEIPAGGRVGFDPFLLSIDTWESYDLALQGSNRQLVSITTNLVDLVWGSERPPVPNQPIYALQEAFTGSTWQEKVSGVRSQMQKHQKVPTAVLLSALEETAWLFNLRASDIPYNPFFYSYTLLTDSSIRLFANKSRFSSETLSYLNSSCTGPMCVQIEDYSQVRDSIQAYSLGDVRIWIGTSYTMYGIYEMIPKEKLVTDTYSPVMMTKAVKNSKEQALLKASHVRDAVAVIRYLVWLEKNVPKGTVDEFSGAEIVDKFRGEEQFSSGPSFETISASGLNAALAHYSPTKELNRKLSSDEMYLLDSGGQYWDGTTDITRTVHWGTPSAFQKEAYTRVLIGNIDLSRLIFPAATSGRMVEAFARRALWDAGLNYGHGTGHGIGNFLCVHEWPVGFQSNNIAMAKGMFTSIEPGYYKDGEFGIRLEDVALVVEAKTKYPGSYLTFEVVSFVPYDRNLIDVSLLSPEHLQYLNRYYQTIREKVGPELQRRQLLEEFEWLQQHTEPLAALEHHHHHH
Molecular weight 72.1kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >15% by SDS-PAGE
Buffer PBS,pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly21-Ala650
Protein Accession O43895
Spec:Entrez GeneID 7512
Spec:NCBI Gene Aliases APP2; AEACEI
Spec:SwissProtID O75994
NCBI Reference O43895
Aliases /Synonyms Aminoacylproline aminopeptidase,Membrane-bound aminopeptidase P,Membrane-bound APP,Membrane-bound AmP,mAmP,X-Pro aminopeptidase 2
Reference PX-P4837
Note For research use only
Molecular Constructor
Gly21–Ala650 His

There are no reviews yet.

Be the first to review “Xaa-Pro aminopeptidase 2(XPNPEP2)”

Your email address will not be published. Required fields are marked *

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products